From ad273dbe5dba7bd0e901270464e25fc1f030a5b5 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Tobias=20Erbsh=C3=A4u=C3=9Fer?= Date: Sun, 24 May 2026 09:40:13 +0200 Subject: [PATCH] Squashed 'backend/goldmark/' content from commit 379bf24 git-subtree-dir: backend/goldmark git-subtree-split: 379bf24a47e6ef07f34d7536aead86d8792ac300 --- .github/FUNDING.yml | 1 + .github/ISSUE_TEMPLATE.md | 17 + .../ISSUE_TEMPLATE/general-issue-template.md | 26 + .../pull_request_template.md | 5 + .github/workflows/stale.yaml | 26 + .github/workflows/test.yaml | 33 + .gitignore | 21 + .golangci.yml | 102 + LICENSE | 21 + Makefile | 16 + README.md | 575 + _benchmark/cmark/.gitignore | 5 + _benchmark/cmark/Makefile | 33 + _benchmark/cmark/_data.md | 9702 +++++++++++++++++ _benchmark/cmark/cmark_benchmark.c | 91 + _benchmark/cmark/goldmark_benchmark.go | 59 + _benchmark/go/_data.md | 9702 +++++++++++++++++ _benchmark/go/benchmark_test.go | 95 + _benchmark/go/go.mod | 28 + _benchmark/go/go.sum | 40 + _test/extra.txt | 885 ++ _test/options.txt | 78 + _test/spec.json | 5218 +++++++++ _tools/gen-emb-structs.go | 143 + _tools/gen-oss-fuzz-corpus.go | 61 + _tools/gen-unicode-case-folding-map.go | 108 + _tools/html5entities.json | 2133 ++++ _tools/main.go | 45 + _tools/unicode-case-folding-map.json | 9309 ++++++++++++++++ ast/ast.go | 559 + ast/ast_test.go | 60 + ast/block.go | 622 ++ ast/inline.go | 663 ++ ast_test.go | 336 + commonmark_test.go | 57 + extension/_test/definition_list.txt | 157 + extension/_test/footnote.txt | 91 + extension/_test/linkify.txt | 193 + extension/_test/strikethrough.txt | 39 + extension/_test/table.txt | 293 + extension/_test/tasklist.txt | 51 + extension/_test/typographer.txt | 143 + extension/ast/definition_list.go | 99 + extension/ast/footnote.go | 138 + extension/ast/strikethrough.go | 29 + extension/ast/table.go | 159 + extension/ast/tasklist.go | 36 + extension/ast_test.go | 123 + extension/cjk.go | 72 + extension/cjk_test.go | 269 + extension/definition_list.go | 274 + extension/definition_list_test.go | 21 + extension/footnote.go | 691 ++ extension/footnote_test.go | 141 + extension/gfm.go | 18 + extension/linkify.go | 323 + extension/linkify_test.go | 100 + extension/package.go | 2 + extension/strikethrough.go | 118 + extension/strikethrough_test.go | 21 + extension/table.go | 569 + extension/table_test.go | 394 + extension/tasklist.go | 120 + extension/tasklist_test.go | 21 + extension/typographer.go | 348 + extension/typographer_test.go | 21 + extra_test.go | 281 + fuzz/fuzz_test.go | 57 + fuzz/oss_fuzz_test.go | 9 + go.mod | 3 + go.sum | 0 markdown.go | 141 + options_test.go | 19 + parser/attribute.go | 329 + parser/atx_heading.go | 219 + parser/auto_link.go | 42 + parser/blockquote.go | 70 + parser/code_block.go | 102 + parser/code_span.go | 84 + parser/delimiter.go | 239 + parser/emphasis.go | 50 + parser/fcode_block.go | 112 + parser/html_block.go | 226 + parser/link.go | 458 + parser/link_ref.go | 164 + parser/list.go | 279 + parser/list_item.go | 90 + parser/paragraph.go | 71 + parser/parser.go | 1280 +++ parser/raw_html.go | 153 + parser/setext_headings.go | 127 + parser/thematic_break.go | 75 + renderer/html/html.go | 962 ++ renderer/renderer.go | 174 + testutil/testutil.go | 405 + testutil/testutil_test.go | 7 + text/package.go | 2 + text/reader.go | 701 ++ text/reader_test.go | 16 + text/segment.go | 233 + util/html5entities.gen.go | 9 + util/html5entities.go | 47 + util/unicode_case_folding.gen.go | 6 + util/unicode_case_folding.go | 17 + util/util.go | 1044 ++ util/util_cjk.go | 469 + util/util_safe.go | 14 + util/util_unsafe_go120.go | 24 + util/util_unsafe_go121.go | 18 + 109 files changed, 54777 insertions(+) create mode 100644 .github/FUNDING.yml create mode 100644 .github/ISSUE_TEMPLATE.md create mode 100644 .github/ISSUE_TEMPLATE/general-issue-template.md create mode 100644 .github/PULL_REQUEST_TEMPLATE/pull_request_template.md create mode 100644 .github/workflows/stale.yaml create mode 100644 .github/workflows/test.yaml create mode 100644 .gitignore create mode 100644 .golangci.yml create mode 100644 LICENSE create mode 100644 Makefile create mode 100644 README.md create mode 100644 _benchmark/cmark/.gitignore create mode 100644 _benchmark/cmark/Makefile create mode 100644 _benchmark/cmark/_data.md create mode 100644 _benchmark/cmark/cmark_benchmark.c create mode 100644 _benchmark/cmark/goldmark_benchmark.go create mode 100644 _benchmark/go/_data.md create mode 100644 _benchmark/go/benchmark_test.go create mode 100644 _benchmark/go/go.mod create mode 100644 _benchmark/go/go.sum create mode 100644 _test/extra.txt create mode 100644 _test/options.txt create mode 100644 _test/spec.json create mode 100644 _tools/gen-emb-structs.go create mode 100644 _tools/gen-oss-fuzz-corpus.go create mode 100644 _tools/gen-unicode-case-folding-map.go create mode 100644 _tools/html5entities.json create mode 100644 _tools/main.go create mode 100644 _tools/unicode-case-folding-map.json create mode 100644 ast/ast.go create mode 100644 ast/ast_test.go create mode 100644 ast/block.go create mode 100644 ast/inline.go create mode 100644 ast_test.go create mode 100644 commonmark_test.go create mode 100644 extension/_test/definition_list.txt create mode 100644 extension/_test/footnote.txt create mode 100644 extension/_test/linkify.txt create mode 100644 extension/_test/strikethrough.txt create mode 100644 extension/_test/table.txt create mode 100644 extension/_test/tasklist.txt create mode 100644 extension/_test/typographer.txt create mode 100644 extension/ast/definition_list.go create mode 100644 extension/ast/footnote.go create mode 100644 extension/ast/strikethrough.go create mode 100644 extension/ast/table.go create mode 100644 extension/ast/tasklist.go create mode 100644 extension/ast_test.go create mode 100644 extension/cjk.go create mode 100644 extension/cjk_test.go create mode 100644 extension/definition_list.go create mode 100644 extension/definition_list_test.go create mode 100644 extension/footnote.go create mode 100644 extension/footnote_test.go create mode 100644 extension/gfm.go create mode 100644 extension/linkify.go create mode 100644 extension/linkify_test.go create mode 100644 extension/package.go create mode 100644 extension/strikethrough.go create mode 100644 extension/strikethrough_test.go create mode 100644 extension/table.go create mode 100644 extension/table_test.go create mode 100644 extension/tasklist.go create mode 100644 extension/tasklist_test.go create mode 100644 extension/typographer.go create mode 100644 extension/typographer_test.go create mode 100644 extra_test.go create mode 100644 fuzz/fuzz_test.go create mode 100644 fuzz/oss_fuzz_test.go create mode 100644 go.mod create mode 100644 go.sum create mode 100644 markdown.go create mode 100644 options_test.go create mode 100644 parser/attribute.go create mode 100644 parser/atx_heading.go create mode 100644 parser/auto_link.go create mode 100644 parser/blockquote.go create mode 100644 parser/code_block.go create mode 100644 parser/code_span.go create mode 100644 parser/delimiter.go create mode 100644 parser/emphasis.go create mode 100644 parser/fcode_block.go create mode 100644 parser/html_block.go create mode 100644 parser/link.go create mode 100644 parser/link_ref.go create mode 100644 parser/list.go create mode 100644 parser/list_item.go create mode 100644 parser/paragraph.go create mode 100644 parser/parser.go create mode 100644 parser/raw_html.go create mode 100644 parser/setext_headings.go create mode 100644 parser/thematic_break.go create mode 100644 renderer/html/html.go create mode 100644 renderer/renderer.go create mode 100644 testutil/testutil.go create mode 100644 testutil/testutil_test.go create mode 100644 text/package.go create mode 100644 text/reader.go create mode 100644 text/reader_test.go create mode 100644 text/segment.go create mode 100644 util/html5entities.gen.go create mode 100644 util/html5entities.go create mode 100644 util/unicode_case_folding.gen.go create mode 100644 util/unicode_case_folding.go create mode 100644 util/util.go create mode 100644 util/util_cjk.go create mode 100644 util/util_safe.go create mode 100644 util/util_unsafe_go120.go create mode 100644 util/util_unsafe_go121.go diff --git a/.github/FUNDING.yml b/.github/FUNDING.yml new file mode 100644 index 0000000..a560df9 --- /dev/null +++ b/.github/FUNDING.yml @@ -0,0 +1 @@ +github: [yuin] diff --git a/.github/ISSUE_TEMPLATE.md b/.github/ISSUE_TEMPLATE.md new file mode 100644 index 0000000..51e3b62 --- /dev/null +++ b/.github/ISSUE_TEMPLATE.md @@ -0,0 +1,17 @@ +goldmark has [https://github.com/yuin/goldmark/discussions](Discussions) in github. +You should post only issues here. Feature requests and questions should be posted at discussions. + + +- [ ] goldmark is fully compliant with the CommonMark. Before submitting issue, you **must** read [CommonMark spec](https://spec.commonmark.org/0.29/) and confirm your output is different from [CommonMark online demo](https://spec.commonmark.org/dingus/). + - [ ] **Extensions(Autolink without `<` `>`, Table, etc) are not part of CommonMark spec.** You should confirm your output is different from other official renderers correspond with an extension. +- [ ] **goldmark is not dedicated for Hugo**. If you are Hugo user and your issue was raised by your experience in Hugo, **you should consider create issue at Hugo repository at first** . + +Please answer the following before submitting your issue: + +1. What version of goldmark are you using? : +2. What version of Go are you using? : +3. What operating system and processor architecture are you using? : +4. What did you do? : +5. What did you expect to see? : +6. What did you see instead? : +7. Did you confirm your output is different from [CommonMark online demo](https://spec.commonmark.org/dingus/) or other official renderer correspond with an extension?: diff --git a/.github/ISSUE_TEMPLATE/general-issue-template.md b/.github/ISSUE_TEMPLATE/general-issue-template.md new file mode 100644 index 0000000..1ab558e --- /dev/null +++ b/.github/ISSUE_TEMPLATE/general-issue-template.md @@ -0,0 +1,26 @@ +--- +name: General issue template +about: must use this template +title: '' +labels: '' +assignees: '' + +--- + +goldmark has [https://github.com/yuin/goldmark/discussions](Discussions) in github. +You should post only issues here. Feature requests and questions should be posted at discussions. + +- [ ] goldmark is fully compliant with the CommonMark. Before submitting issue, you **must** read [CommonMark spec](https://spec.commonmark.org/0.29/) and confirm your output is different from [CommonMark online demo](https://spec.commonmark.org/dingus/). + - [ ] **Extensions(Autolink without `<` `>`, Table, etc) are not part of CommonMark spec.** You should confirm your output is different from other official renderers correspond with an extension. +- [ ] **goldmark is not dedicated for Hugo**. If you are Hugo user and your issue was raised by your experience in Hugo, **you should consider create issue at Hugo repository at first** . +- [ ] goldmark is a CommonMark parser. I do not discuss about specs here. Please post your questions about CommonMark specs at [CommonMark spec repository](https://github.com/commonmark/commonmark-spec/issues). + +Please answer the following before submitting your issue: + +1. What version of goldmark are you using? : +2. What version of Go are you using? : +3. What operating system and processor architecture are you using? : +4. What did you do? : +5. What did you expect to see? : +6. What did you see instead? : +7. Did you confirm your output is different from [CommonMark online demo](https://spec.commonmark.org/dingus/) or other official renderer correspond with an extension?: diff --git a/.github/PULL_REQUEST_TEMPLATE/pull_request_template.md b/.github/PULL_REQUEST_TEMPLATE/pull_request_template.md new file mode 100644 index 0000000..08cd292 --- /dev/null +++ b/.github/PULL_REQUEST_TEMPLATE/pull_request_template.md @@ -0,0 +1,5 @@ +- [ ] goldmark is an extensible library. I will no longer accept PRs that add non-CommonMark features to the core parser. Please implement non-CommonMark features as extensions. + - [ ] If you need addtional goldmark functionalities for implementing non-CommonMark features, please create PR that only adds these functionalities without extensions adding non-CommonMark features. + - DO NOT hesitate copy&paste some logics from goldmark. Copy&paste is not always bad. Many users claim like 'To implement this as an external extension, it would require copy and paste from goldmark, so I implemented it in the core.' . Please copy&paste some logics from goldmark if needed. + - I welcome PRs that add your extensions to README :) +- [ ] goldmark is a CommonMark parser. I do not discuss about specs here. Please post your questions about CommonMark specs at [CommonMark spec repository](https://github.com/commonmark/commonmark-spec/issues). diff --git a/.github/workflows/stale.yaml b/.github/workflows/stale.yaml new file mode 100644 index 0000000..57c0a59 --- /dev/null +++ b/.github/workflows/stale.yaml @@ -0,0 +1,26 @@ +name: Close inactive issues +on: + schedule: + - cron: "30 9 * * *" +jobs: + close-issues: + runs-on: ubuntu-latest + permissions: + issues: write + pull-requests: write + steps: + - uses: actions/stale@v5 + with: + days-before-issue-stale: 30 + days-before-issue-close: 14 + stale-issue-label: "stale" + stale-issue-message: "This issue is stale because it has been open for 30 days with no activity." + close-issue-message: "This issue was closed because it has been inactive for 14 days since being marked as stale." + exempt-issue-labels: "pinned,security" + days-before-pr-stale: 180 + days-before-pr-close: 14 + stale-pr-label: "stale" + stale-pr-message: "This PR is stale because it has been open for 180 days with no activity." + close-pr-message: "This PR was closed because it has been inactive for 14 days since being marked as stale." + exempt-pr-labels: "pinned,security" + repo-token: ${{ secrets.GITHUB_TOKEN }} diff --git a/.github/workflows/test.yaml b/.github/workflows/test.yaml new file mode 100644 index 0000000..fbb5663 --- /dev/null +++ b/.github/workflows/test.yaml @@ -0,0 +1,33 @@ +on: [push, pull_request] +name: test +jobs: + test: + strategy: + fail-fast: false + matrix: + go-version: [1.22.x,1.23.x,1.24.x] + platform: [ubuntu-latest, macos-latest, windows-latest] + runs-on: ${{ matrix.platform }} + steps: + - name: Install Go + uses: actions/setup-go@v4 + with: + go-version: ${{ matrix.go-version }} + - name: Checkout code + uses: actions/checkout@v3 + - name: Run lints + uses: golangci/golangci-lint-action@v6 + with: + version: latest + if: "matrix.platform == 'ubuntu-latest'" # gofmt linter fails on Windows for CRLF problems + - name: Run tests + env: + GOLDMARK_TEST_TIMEOUT_MULTIPLIER: 5 + run: go test -v ./... -covermode=count -coverprofile=coverage.out -coverpkg=./... + - name: Install goveralls + run: go install github.com/mattn/goveralls@latest + - name: Send coverage + if: "matrix.platform == 'ubuntu-latest'" + env: + COVERALLS_TOKEN: ${{ secrets.GITHUB_TOKEN }} + run: goveralls -coverprofile=coverage.out -service=github diff --git a/.gitignore b/.gitignore new file mode 100644 index 0000000..abcfac3 --- /dev/null +++ b/.gitignore @@ -0,0 +1,21 @@ +# Binaries for programs and plugins +*.exe +*.exe~ +*.dll +*.so +*.dylib + +# Test binary, build with `go test -c` +*.test +*.pprof + +# Output of the go coverage tool, specifically when used with LiteIDE +*.out + +.DS_Store +fuzz/corpus +fuzz/crashers +fuzz/suppressions +fuzz/fuzz-fuzz.zip + +cmd diff --git a/.golangci.yml b/.golangci.yml new file mode 100644 index 0000000..adfa4d0 --- /dev/null +++ b/.golangci.yml @@ -0,0 +1,102 @@ +issues: + exclude-use-default: false + exclude-rules: + - path: _test.go + linters: + - errcheck + - lll + exclude: + - "Package util" + +linters: + disable-all: true + enable: + - errcheck + - gosimple + - govet + - ineffassign + - staticcheck + - typecheck + - unused + - gofmt + - godot + - makezero + - misspell + - revive + - wastedassign + - lll + +linters-settings: + revive: + severity: "warning" + confidence: 0.8 + rules: + - name: blank-imports + severity: warning + disabled: false + - name: context-as-argument + severity: warning + disabled: false + - name: context-keys-type + severity: warning + disabled: false + - name: dot-imports + severity: warning + disabled: true + - name: error-return + severity: warning + disabled: false + - name: error-strings + severity: warning + disabled: false + - name: error-naming + severity: warning + disabled: false + - name: exported + severity: warning + disabled: false + - name: increment-decrement + severity: warning + disabled: false + - name: var-naming + severity: warning + disabled: false + - name: var-declaration + severity: warning + disabled: false + - name: package-comments + severity: warning + disabled: false + - name: range + severity: warning + disabled: false + - name: receiver-naming + severity: warning + disabled: false + - name: time-naming + severity: warning + disabled: false + - name: unexported-return + severity: warning + disabled: false + - name: indent-error-flow + severity: warning + disabled: false + - name: errorf + severity: warning + disabled: false + - name: empty-block + severity: warning + disabled: true + - name: superfluous-else + severity: warning + disabled: false + - name: unused-parameter + severity: warning + disabled: true + - name: unreachable-code + severity: warning + disabled: false + - name: redefines-builtin-id + severity: warning + disabled: false diff --git a/LICENSE b/LICENSE new file mode 100644 index 0000000..dc5b2a6 --- /dev/null +++ b/LICENSE @@ -0,0 +1,21 @@ +MIT License + +Copyright (c) 2019 Yusuke Inuzuka + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. diff --git a/Makefile b/Makefile new file mode 100644 index 0000000..7bef51b --- /dev/null +++ b/Makefile @@ -0,0 +1,16 @@ +.PHONY: test fuzz lint gen + +lint: + golangci-lint run -c .golangci.yml ./... + +test: + go test -coverprofile=profile.out -coverpkg=github.com/yuin/goldmark,github.com/yuin/goldmark/ast,github.com/yuin/goldmark/extension,github.com/yuin/goldmark/extension/ast,github.com/yuin/goldmark/parser,github.com/yuin/goldmark/renderer,github.com/yuin/goldmark/renderer/html,github.com/yuin/goldmark/text,github.com/yuin/goldmark/util ./... + +cov: test + go tool cover -html=profile.out + +fuzz: + cd ./fuzz && go test -fuzz=FuzzDefault + +gen: + go generate ./... diff --git a/README.md b/README.md new file mode 100644 index 0000000..9cf4110 --- /dev/null +++ b/README.md @@ -0,0 +1,575 @@ +goldmark +========================================== + +[![https://pkg.go.dev/github.com/yuin/goldmark](https://pkg.go.dev/badge/github.com/yuin/goldmark.svg)](https://pkg.go.dev/github.com/yuin/goldmark) +[![https://github.com/yuin/goldmark/actions?query=workflow:test](https://github.com/yuin/goldmark/actions/workflows/test.yaml/badge.svg?branch=master&event=push)](https://github.com/yuin/goldmark/actions?query=workflow:test) +[![https://coveralls.io/github/yuin/goldmark](https://coveralls.io/repos/github/yuin/goldmark/badge.svg?branch=master)](https://coveralls.io/github/yuin/goldmark) +[![https://goreportcard.com/report/github.com/yuin/goldmark](https://goreportcard.com/badge/github.com/yuin/goldmark)](https://goreportcard.com/report/github.com/yuin/goldmark) + +> A Markdown parser written in Go. Easy to extend, standards-compliant, well-structured. + +goldmark is compliant with CommonMark 0.31.2. + +- [goldmark playground](https://yuin.github.io/goldmark/playground/) : Try goldmark online. This playground is built with WASM(5-10MB). + +There is also a Rust version of goldmark: [rushdown](https://github.com/yuin/rushdown) + +Motivation +---------------------- +I needed a Markdown parser for Go that satisfies the following requirements: + +- Easy to extend. + - Markdown is poor in document expressions compared to other light markup languages such as reStructuredText. + - We have extensions to the Markdown syntax, e.g. PHP Markdown Extra, GitHub Flavored Markdown. +- Standards-compliant. + - Markdown has many dialects. + - GitHub-Flavored Markdown is widely used and is based upon CommonMark, effectively mooting the question of whether or not CommonMark is an ideal specification. + - CommonMark is complicated and hard to implement. +- Well-structured. + - AST-based; preserves source position of nodes. +- Written in pure Go. + +[golang-commonmark](https://gitlab.com/golang-commonmark/markdown) may be a good choice, but it seems to be a copy of [markdown-it](https://github.com/markdown-it). + +[blackfriday.v2](https://github.com/russross/blackfriday/tree/v2) is a fast and widely-used implementation, but is not CommonMark-compliant and cannot be extended from outside of the package, since its AST uses structs instead of interfaces. + +Furthermore, its behavior differs from other implementations in some cases, especially regarding lists: [Deep nested lists don't output correctly #329](https://github.com/russross/blackfriday/issues/329), [List block cannot have a second line #244](https://github.com/russross/blackfriday/issues/244), etc. + +This behavior sometimes causes problems. If you migrate your Markdown text from GitHub to blackfriday-based wikis, many lists will immediately be broken. + +As mentioned above, CommonMark is complicated and hard to implement, so Markdown parsers based on CommonMark are few and far between. + +Features +---------------------- + +- **Standards-compliant.** goldmark is fully compliant with the latest [CommonMark](https://commonmark.org/) specification. +- **Extensible.** Do you want to add a `@username` mention syntax to Markdown? + You can easily do so in goldmark. You can add your AST nodes, + parsers for block-level elements, parsers for inline-level elements, + transformers for paragraphs, transformers for the whole AST structure, and + renderers. +- **Performance.** goldmark's performance is on par with that of cmark, + the CommonMark reference implementation written in C. +- **Robust.** goldmark is tested with `go test --fuzz`. +- **Built-in extensions.** goldmark ships with common extensions like tables, strikethrough, + task lists, and definition lists. +- **Depends only on standard libraries.** + +Installation +---------------------- +```bash +$ go get github.com/yuin/goldmark +``` + + +Usage +---------------------- +Import packages: + +```go +import ( + "bytes" + "github.com/yuin/goldmark" +) +``` + + +Convert Markdown documents with the CommonMark-compliant mode: + +```go +var buf bytes.Buffer +if err := goldmark.Convert(source, &buf); err != nil { + panic(err) +} +``` + +With options +------------------------------ + +```go +var buf bytes.Buffer +if err := goldmark.Convert(source, &buf, parser.WithContext(ctx)); err != nil { + panic(err) +} +``` + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `parser.WithContext` | A `parser.Context` | Context for the parsing phase. | + +Context options +---------------------- + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `parser.WithIDs` | A `parser.IDs` | `IDs` allows you to change logics that are related to element id(ex: Auto heading id generation). | + + +Custom parser and renderer +-------------------------- +```go +import ( + "bytes" + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/extension" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer/html" +) + +md := goldmark.New( + goldmark.WithExtensions(extension.GFM), + goldmark.WithParserOptions( + parser.WithAutoHeadingID(), + ), + goldmark.WithRendererOptions( + html.WithHardWraps(), + html.WithXHTML(), + ), + ) +var buf bytes.Buffer +if err := md.Convert(source, &buf); err != nil { + panic(err) +} +``` + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `goldmark.WithParser` | `parser.Parser` | This option must be passed before `goldmark.WithParserOptions` and `goldmark.WithExtensions` | +| `goldmark.WithRenderer` | `renderer.Renderer` | This option must be passed before `goldmark.WithRendererOptions` and `goldmark.WithExtensions` | +| `goldmark.WithParserOptions` | `...parser.Option` | | +| `goldmark.WithRendererOptions` | `...renderer.Option` | | +| `goldmark.WithExtensions` | `...goldmark.Extender` | | + +Parser and Renderer options +------------------------------ + +### Parser options + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `parser.WithBlockParsers` | A `util.PrioritizedSlice` whose elements are `parser.BlockParser` | Parsers for parsing block level elements. | +| `parser.WithInlineParsers` | A `util.PrioritizedSlice` whose elements are `parser.InlineParser` | Parsers for parsing inline level elements. | +| `parser.WithParagraphTransformers` | A `util.PrioritizedSlice` whose elements are `parser.ParagraphTransformer` | Transformers for transforming paragraph nodes. | +| `parser.WithASTTransformers` | A `util.PrioritizedSlice` whose elements are `parser.ASTTransformer` | Transformers for transforming an AST. | +| `parser.WithAutoHeadingID` | `-` | Enables auto heading ids. | +| `parser.WithAttribute` | `-` | Enables custom attributes. Currently only headings supports attributes. | + +### HTML Renderer options + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `html.WithWriter` | `html.Writer` | `html.Writer` for writing contents to an `io.Writer`. | +| `html.WithHardWraps` | `-` | Render newlines as `
`.| +| `html.WithXHTML` | `-` | Render as XHTML. | +| `html.WithUnsafe` | `-` | By default, goldmark does not render raw HTML or potentially dangerous links. With this option, goldmark renders such content as written. | + +### Built-in extensions + +- `extension.Table` + - [GitHub Flavored Markdown: Tables](https://github.github.com/gfm/#tables-extension-) +- `extension.Strikethrough` + - [GitHub Flavored Markdown: Strikethrough](https://github.github.com/gfm/#strikethrough-extension-) +- `extension.Linkify` + - [GitHub Flavored Markdown: Autolinks](https://github.github.com/gfm/#autolinks-extension-) +- `extension.TaskList` + - [GitHub Flavored Markdown: Task list items](https://github.github.com/gfm/#task-list-items-extension-) +- `extension.GFM` + - This extension enables Table, Strikethrough, Linkify and TaskList. + - This extension does not filter tags defined in [6.11: Disallowed Raw HTML (extension)](https://github.github.com/gfm/#disallowed-raw-html-extension-). + If you need to filter HTML tags, see [Security](#security). + - If you need to parse github emojis, you can use [goldmark-emoji](https://github.com/yuin/goldmark-emoji) extension. +- `extension.DefinitionList` + - [PHP Markdown Extra: Definition lists](https://michelf.ca/projects/php-markdown/extra/#def-list) +- `extension.Footnote` + - [PHP Markdown Extra: Footnotes](https://michelf.ca/projects/php-markdown/extra/#footnotes) +- `extension.Typographer` + - This extension substitutes punctuations with typographic entities like [smartypants](https://daringfireball.net/projects/smartypants/). +- `extension.CJK` + - This extension is a shortcut for CJK related functionalities. + +### Attributes +The `parser.WithAttribute` option allows you to define attributes on some elements. + +Currently only headings support attributes. + +**Attributes are being discussed in the +[CommonMark forum](https://talk.commonmark.org/t/consistent-attribute-syntax/272). +This syntax may possibly change in the future.** + + +#### Headings + +``` +## heading ## {#id .className attrName=attrValue class="class1 class2"} + +## heading {#id .className attrName=attrValue class="class1 class2"} +``` + +``` +heading {#id .className attrName=attrValue} +============ +``` + +### Table extension +The Table extension implements [Table(extension)](https://github.github.com/gfm/#tables-extension-), as +defined in [GitHub Flavored Markdown Spec](https://github.github.com/gfm/). + +Specs are defined for XHTML, so specs use some deprecated attributes for HTML5. + +You can override alignment rendering method via options. + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `extension.WithTableCellAlignMethod` | `extension.TableCellAlignMethod` | Option indicates how are table cells aligned. | + +### Typographer extension + +The Typographer extension translates plain ASCII punctuation characters into typographic-punctuation HTML entities. + +Default substitutions are: + +| Punctuation | Default entity | +| ------------ | ---------- | +| `'` | `‘`, `’` | +| `"` | `“`, `”` | +| `--` | `–` | +| `---` | `—` | +| `...` | `…` | +| `<<` | `«` | +| `>>` | `»` | + +You can override the default substitutions via `extensions.WithTypographicSubstitutions`: + +```go +markdown := goldmark.New( + goldmark.WithExtensions( + extension.NewTypographer( + extension.WithTypographicSubstitutions(extension.TypographicSubstitutions{ + extension.LeftSingleQuote: []byte("‚"), + extension.RightSingleQuote: nil, // nil disables a substitution + }), + ), + ), +) +``` + +### Linkify extension + +The Linkify extension implements [Autolinks(extension)](https://github.github.com/gfm/#autolinks-extension-), as +defined in [GitHub Flavored Markdown Spec](https://github.github.com/gfm/). + +Since the spec does not define details about URLs, there are numerous ambiguous cases. + +You can override autolinking patterns via options. + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `extension.WithLinkifyAllowedProtocols` | `[][]byte \| []string` | List of allowed protocols such as `[]string{ "http:" }` | +| `extension.WithLinkifyURLRegexp` | `*regexp.Regexp` | Regexp that defines URLs, including protocols | +| `extension.WithLinkifyWWWRegexp` | `*regexp.Regexp` | Regexp that defines URL starting with `www.`. This pattern corresponds to [the extended www autolink](https://github.github.com/gfm/#extended-www-autolink) | +| `extension.WithLinkifyEmailRegexp` | `*regexp.Regexp` | Regexp that defines email addresses` | + +Example, using [xurls](https://github.com/mvdan/xurls): + +```go +import "mvdan.cc/xurls/v2" + +markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + extension.NewLinkify( + extension.WithLinkifyAllowedProtocols([]string{ + "http:", + "https:", + }), + extension.WithLinkifyURLRegexp( + xurls.Strict(), + ), + ), + ), +) +``` + +### Footnotes extension + +The Footnote extension implements [PHP Markdown Extra: Footnotes](https://michelf.ca/projects/php-markdown/extra/#footnotes). + +This extension has some options: + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `extension.WithFootnoteIDPrefix` | `[]byte \| string` | a prefix for the id attributes.| +| `extension.WithFootnoteIDPrefixFunction` | `func(gast.Node) []byte` | a function that determines the id attribute for given Node.| +| `extension.WithFootnoteLinkTitle` | `[]byte \| string` | an optional title attribute for footnote links.| +| `extension.WithFootnoteBacklinkTitle` | `[]byte \| string` | an optional title attribute for footnote backlinks. | +| `extension.WithFootnoteLinkClass` | `[]byte \| string` | a class for footnote links. This defaults to `footnote-ref`. | +| `extension.WithFootnoteBacklinkClass` | `[]byte \| string` | a class for footnote backlinks. This defaults to `footnote-backref`. | +| `extension.WithFootnoteBacklinkHTML` | `[]byte \| string` | a class for footnote backlinks. This defaults to `↩︎`. | + +Some options can have special substitutions. Occurrences of “^^” in the string will be replaced by the corresponding footnote number in the HTML output. Occurrences of “%%” will be replaced by a number for the reference (footnotes can have multiple references). + +`extension.WithFootnoteIDPrefix` and `extension.WithFootnoteIDPrefixFunction` are useful if you have multiple Markdown documents displayed inside one HTML document to avoid footnote ids to clash each other. + +`extension.WithFootnoteIDPrefix` sets fixed id prefix, so you may write codes like the following: + +```go +for _, path := range files { + source := readAll(path) + prefix := getPrefix(path) + + markdown := goldmark.New( + goldmark.WithExtensions( + NewFootnote( + WithFootnoteIDPrefix(path), + ), + ), + ) + var b bytes.Buffer + err := markdown.Convert(source, &b) + if err != nil { + t.Error(err.Error()) + } +} +``` + +`extension.WithFootnoteIDPrefixFunction` determines an id prefix by calling given function, so you may write codes like the following: + +```go +markdown := goldmark.New( + goldmark.WithExtensions( + NewFootnote( + WithFootnoteIDPrefixFunction(func(n gast.Node) []byte { + v, ok := n.OwnerDocument().Meta()["footnote-prefix"] + if ok { + return util.StringToReadOnlyBytes(v.(string)) + } + return nil + }), + ), + ), +) + +for _, path := range files { + source := readAll(path) + var b bytes.Buffer + + doc := markdown.Parser().Parse(text.NewReader(source)) + doc.Meta()["footnote-prefix"] = getPrefix(path) + err := markdown.Renderer().Render(&b, source, doc) +} +``` + +You can use [goldmark-meta](https://github.com/yuin/goldmark-meta) to define a id prefix in the markdown document: + + +```markdown +--- +title: document title +slug: article1 +footnote-prefix: article1 +--- + +# My article + +``` + +### CJK extension +CommonMark gives compatibilities a high priority and original markdown was designed by westerners. So CommonMark lacks considerations for languages like CJK. + +This extension provides additional options for CJK users. + +| Functional option | Type | Description | +| ----------------- | ---- | ----------- | +| `extension.WithEastAsianLineBreaks` | `...extension.EastAsianLineBreaksStyle` | Soft line breaks are rendered as a newline. Some asian users will see it as an unnecessary space. With this option, soft line breaks between east asian wide characters will be ignored. This defaults to `EastAsianLineBreaksStyleSimple`. | +| `extension.WithEscapedSpace` | `-` | Without spaces around an emphasis started with east asian punctuations, it is not interpreted as an emphasis(as defined in CommonMark spec). With this option, you can avoid this inconvenient behavior by putting 'not rendered' spaces around an emphasis like `太郎は\ **「こんにちわ」**\ といった`. | + +#### Styles of Line Breaking + +| Style | Description | +| ----- | ----------- | +| `EastAsianLineBreaksStyleSimple` | Soft line breaks are ignored if both sides of the break are east asian wide character. This behavior is the same as [`east_asian_line_breaks`](https://pandoc.org/MANUAL.html#extension-east_asian_line_breaks) in Pandoc. | +| `EastAsianLineBreaksCSS3Draft` | This option implements CSS text level3 [Segment Break Transformation Rules](https://drafts.csswg.org/css-text-3/#line-break-transform) with [some enhancements](https://github.com/w3c/csswg-drafts/issues/5086). | + +#### Example of `EastAsianLineBreaksStyleSimple` + +Input Markdown: + +```md +私はプログラマーです。 +東京の会社に勤めています。 +GoでWebアプリケーションを開発しています。 +``` + +Output: + +```html +

私はプログラマーです。東京の会社に勤めています。\nGoでWebアプリケーションを開発しています。

+``` + +#### Example of `EastAsianLineBreaksCSS3Draft` + +Input Markdown: + +```md +私はプログラマーです。 +東京の会社に勤めています。 +GoでWebアプリケーションを開発しています。 +``` + +Output: + +```html +

私はプログラマーです。東京の会社に勤めています。GoでWebアプリケーションを開発しています。

+``` + +Security +-------------------- +By default, goldmark does not render raw HTML or potentially-dangerous URLs. +If you need to gain more control over untrusted contents, it is recommended that you +use an HTML sanitizer such as [bluemonday](https://github.com/microcosm-cc/bluemonday). + +Benchmark +-------------------- +You can run this benchmark in the `_benchmark` directory. + +### against other golang libraries + +blackfriday v2 seems to be the fastest, but as it is not CommonMark compliant, its performance cannot be directly compared to that of the CommonMark-compliant libraries. + +goldmark, meanwhile, builds a clean, extensible AST structure, achieves full compliance with +CommonMark, and consumes less memory, all while being reasonably fast. + +- MBP 2019 13″(i5, 16GB), Go1.17 + +``` +BenchmarkMarkdown/Blackfriday-v2-8 302 3743747 ns/op 3290445 B/op 20050 allocs/op +BenchmarkMarkdown/GoldMark-8 280 4200974 ns/op 2559738 B/op 13435 allocs/op +BenchmarkMarkdown/CommonMark-8 226 5283686 ns/op 2702490 B/op 20792 allocs/op +BenchmarkMarkdown/Lute-8 12 92652857 ns/op 10602649 B/op 40555 allocs/op +BenchmarkMarkdown/GoMarkdown-8 13 81380167 ns/op 2245002 B/op 22889 allocs/op +``` + +### against cmark (CommonMark reference implementation written in C) + +- MBP 2019 13″(i5, 16GB), Go1.17 + +``` +----------- cmark ----------- +file: _data.md +iteration: 50 +average: 0.0044073057 sec +------- goldmark ------- +file: _data.md +iteration: 50 +average: 0.0041611990 sec +``` + +As you can see, goldmark's performance is on par with cmark's. + +Extensions +-------------------- +### List of extensions + +- [goldmark-meta](https://github.com/yuin/goldmark-meta): A YAML metadata + extension for the goldmark Markdown parser. +- [goldmark-highlighting](https://github.com/yuin/goldmark-highlighting): A syntax-highlighting extension + for the goldmark markdown parser. +- [goldmark-emoji](https://github.com/yuin/goldmark-emoji): An emoji + extension for the goldmark Markdown parser. +- [goldmark-mathjax](https://github.com/litao91/goldmark-mathjax): Mathjax support for the goldmark markdown parser +- [goldmark-pdf](https://github.com/stephenafamo/goldmark-pdf): A PDF renderer that can be passed to `goldmark.WithRenderer()`. +- [goldmark-hashtag](https://github.com/abhinav/goldmark-hashtag): Adds support for `#hashtag`-based tagging to goldmark. +- [goldmark-wikilink](https://github.com/abhinav/goldmark-wikilink): Adds support for `[[wiki]]`-style links to goldmark. +- [goldmark-anchor](https://github.com/abhinav/goldmark-anchor): Adds anchors (permalinks) next to all headers in a document. +- [goldmark-figure](https://github.com/mangoumbrella/goldmark-figure): Adds support for rendering paragraphs starting with an image to `
` elements. +- [goldmark-frontmatter](https://github.com/abhinav/goldmark-frontmatter): Adds support for YAML, TOML, and custom front matter to documents. +- [goldmark-toc](https://github.com/abhinav/goldmark-toc): Adds support for generating tables-of-contents for goldmark documents. +- [goldmark-mermaid](https://github.com/abhinav/goldmark-mermaid): Adds support for rendering [Mermaid](https://mermaid-js.github.io/mermaid/) diagrams in goldmark documents. +- [goldmark-pikchr](https://github.com/jchenry/goldmark-pikchr): Adds support for rendering [Pikchr](https://pikchr.org/home/doc/trunk/homepage.md) diagrams in goldmark documents. +- [goldmark-embed](https://github.com/13rac1/goldmark-embed): Adds support for rendering embeds from YouTube links. +- [goldmark-latex](https://github.com/soypat/goldmark-latex): A $\LaTeX$ renderer that can be passed to `goldmark.WithRenderer()`. +- [goldmark-fences](https://github.com/stefanfritsch/goldmark-fences): Support for pandoc-style [fenced divs](https://pandoc.org/MANUAL.html#divs-and-spans) in goldmark. +- [goldmark-d2](https://github.com/FurqanSoftware/goldmark-d2): Adds support for [D2](https://d2lang.com/) diagrams. +- [goldmark-katex](https://github.com/FurqanSoftware/goldmark-katex): Adds support for [KaTeX](https://katex.org/) math and equations. +- [goldmark-img64](https://github.com/tenkoh/goldmark-img64): Adds support for embedding images into the document as DataURL (base64 encoded). +- [goldmark-enclave](https://github.com/quailyquaily/goldmark-enclave): Adds support for embedding youtube/bilibili video, X's [oembed X](https://publish.x.com/), [tradingview chart](https://www.tradingview.com/widget/)'s chart, [quaily widget](https://quaily.com), [spotify embeds](https://developer.spotify.com/documentation/embeds), [dify embed](https://dify.ai/) and html audio into the document. +- [goldmark-wiki-table](https://github.com/movsb/goldmark-wiki-table): Adds support for embedding Wiki Tables. +- [goldmark-tgmd](https://github.com/Mad-Pixels/goldmark-tgmd): A Telegram markdown renderer that can be passed to `goldmark.WithRenderer()`. +- [goldmark-treeblood](https://github.com/Wyatt915/goldmark-treeblood): Renders $\LaTeX$ expressions as MathML (pure Go, no external dependencies). +- [goldmark-subtext](https://github.com/zeozeozeo/goldmark-subtext): Support for Discord-style markdown subtexts +- [goldmark-customtag](https://github.com/tendstofortytwo/goldmark-customtag): Allows you to define custom block tags. +- [goldmark-cjk-friendly](https://github.com/tats-u/goldmark-cjk-friendly): Port of npm package [`remark-cjk-friendly` / `markdown-it-cjk-friendly`](https://github.com/tats-u/markdown-cjk-friendly) to goldmark. Similar to the [CJK extension](#cjk-extension) (`WithEscapedSpace`), but you do not need to explicitly add `\ ` around `*` and `**`. You can combine this with the [CJK extension](#cjk-extension). +- [goldmark-chart](https://github.com/TheGreatRambler/goldmark-chart): Generate static ChartJS charts using the simple [Markvis](https://markvis.js.org/#/) format. + +### Loading extensions at runtime +[goldmark-dynamic](https://github.com/yuin/goldmark-dynamic) allows you to write a goldmark extension in Lua and load it at runtime without re-compilation. + +Please refer to [goldmark-dynamic](https://github.com/yuin/goldmark-dynamic) for details. + + +goldmark internal(for extension developers) +---------------------------------------------- +### Overview +goldmark's Markdown processing is outlined in the diagram below. + +``` + + | + V + +-------- parser.Parser --------------------------- + | 1. Parse block elements into AST + | 1. If a parsed block is a paragraph, apply + | ast.ParagraphTransformer + | 2. Traverse AST and parse blocks. + | 1. Process delimiters(emphasis) at the end of + | block parsing + | 3. Apply parser.ASTTransformers to AST + | + V + + | + V + +------- renderer.Renderer ------------------------ + | 1. Traverse AST and apply renderer.NodeRenderer + | corespond to the node type + + | + V + +``` + +### Parsing +Markdown documents are read through `text.Reader` interface. + +AST nodes do not have concrete text. AST nodes have segment information of the documents, represented by `text.Segment` . + +`text.Segment` has 3 attributes: `Start`, `End`, `Padding` . + +(TBC) + +**TODO** + +See `extension` directory for examples of extensions. + +Summary: + +1. Define AST Node as a struct in which `ast.BaseBlock` or `ast.BaseInline` is embedded. +2. Write a parser that implements `parser.BlockParser` or `parser.InlineParser`. +3. Write a renderer that implements `renderer.NodeRenderer`. +4. Define your goldmark extension that implements `goldmark.Extender`. + + +Donation +-------------------- +BTC: 1NEDSyUmo4SMTDP83JJQSWi1MvQUGGNMZB + +License +-------------------- +MIT + +Author +-------------------- +Yusuke Inuzuka diff --git a/_benchmark/cmark/.gitignore b/_benchmark/cmark/.gitignore new file mode 100644 index 0000000..b6a101d --- /dev/null +++ b/_benchmark/cmark/.gitignore @@ -0,0 +1,5 @@ +cmark-master +cmark_benchmark +main +cpu.prof +out.png diff --git a/_benchmark/cmark/Makefile b/_benchmark/cmark/Makefile new file mode 100644 index 0000000..e25039f --- /dev/null +++ b/_benchmark/cmark/Makefile @@ -0,0 +1,33 @@ +CMARK_BIN=cmark_benchmark +CMARK_RUN=LD_LIBRARY_PATH=${LD_LIBRARY_PATH}:./cmark-master/build/src ./$(CMARK_BIN) +ifeq ($(OS),Windows_NT) + CMARK_BIN=cmark_benchmark.exe + CMARK_RUN=bash -c "PATH=./cmark-master/build/src:$${PATH} ./$(CMARK_BIN)" +endif + +.PHONY: run + +run: $(CMARK_BIN) + @ $(CMARK_RUN) + go run ./goldmark_benchmark.go + +./cmark-master/Makefile: + wget -nc -O cmark.zip https://github.com/commonmark/cmark/archive/master.zip + unzip cmark.zip + rm -f cmark.zip + cd cmark-master && make + +$(CMARK_BIN): ./cmark-master/Makefile cmark_benchmark.c + gcc -I./cmark-master/build/src -I./cmark-master/src cmark_benchmark.c -o $(CMARK_BIN) -L./cmark-master/build/src -lcmark; \ + +.PHONY: profile +profile: + go build -o main ./goldmark_benchmark.go + ./main 1000 _data.md cpu.prof + go tool pprof -png main cpu.prof > out.png + rm -f main cpu.prof + + +.PHONY: clean +clean: + rm -f $(CMARK_BIN) diff --git a/_benchmark/cmark/_data.md b/_benchmark/cmark/_data.md new file mode 100644 index 0000000..87db650 --- /dev/null +++ b/_benchmark/cmark/_data.md @@ -0,0 +1,9702 @@ +# Introduction + +## What is Markdown? + +Markdown is a plain text format for writing structured documents, +based on conventions for indicating formatting in email +and usenet posts. It was developed by John Gruber (with +help from Aaron Swartz) and released in 2004 in the form of a +[syntax description](http://daringfireball.net/projects/markdown/syntax) +and a Perl script (`Markdown.pl`) for converting Markdown to +HTML. In the next decade, dozens of implementations were +developed in many languages. Some extended the original +Markdown syntax with conventions for footnotes, tables, and +other document elements. Some allowed Markdown documents to be +rendered in formats other than HTML. Websites like Reddit, +StackOverflow, and GitHub had millions of people using Markdown. +And Markdown started to be used beyond the web, to author books, +articles, slide shows, letters, and lecture notes. + +What distinguishes Markdown from many other lightweight markup +syntaxes, which are often easier to write, is its readability. +As Gruber writes: + +> The overriding design goal for Markdown's formatting syntax is +> to make it as readable as possible. The idea is that a +> Markdown-formatted document should be publishable as-is, as +> plain text, without looking like it's been marked up with tags +> or formatting instructions. +> () + +The point can be illustrated by comparing a sample of +[AsciiDoc](http://www.methods.co.nz/asciidoc/) with +an equivalent sample of Markdown. Here is a sample of +AsciiDoc from the AsciiDoc manual: + +``` +1. List item one. ++ +List item one continued with a second paragraph followed by an +Indented block. ++ +................. +$ ls *.sh +$ mv *.sh ~/tmp +................. ++ +List item continued with a third paragraph. + +2. List item two continued with an open block. ++ +-- +This paragraph is part of the preceding list item. + +a. This list is nested and does not require explicit item +continuation. ++ +This paragraph is part of the preceding list item. + +b. List item b. + +This paragraph belongs to item two of the outer list. +-- +``` + +And here is the equivalent in Markdown: +``` +1. List item one. + + List item one continued with a second paragraph followed by an + Indented block. + + $ ls *.sh + $ mv *.sh ~/tmp + + List item continued with a third paragraph. + +2. List item two continued with an open block. + + This paragraph is part of the preceding list item. + + 1. This list is nested and does not require explicit item continuation. + + This paragraph is part of the preceding list item. + + 2. List item b. + + This paragraph belongs to item two of the outer list. +``` + +The AsciiDoc version is, arguably, easier to write. You don't need +to worry about indentation. But the Markdown version is much easier +to read. The nesting of list items is apparent to the eye in the +source, not just in the processed document. + +## Why is a spec needed? + +John Gruber's [canonical description of Markdown's +syntax](http://daringfireball.net/projects/markdown/syntax) +does not specify the syntax unambiguously. Here are some examples of +questions it does not answer: + +1. How much indentation is needed for a sublist? The spec says that + continuation paragraphs need to be indented four spaces, but is + not fully explicit about sublists. It is natural to think that + they, too, must be indented four spaces, but `Markdown.pl` does + not require that. This is hardly a "corner case," and divergences + between implementations on this issue often lead to surprises for + users in real documents. (See [this comment by John + Gruber](http://article.gmane.org/gmane.text.markdown.general/1997).) + +2. Is a blank line needed before a block quote or heading? + Most implementations do not require the blank line. However, + this can lead to unexpected results in hard-wrapped text, and + also to ambiguities in parsing (note that some implementations + put the heading inside the blockquote, while others do not). + (John Gruber has also spoken [in favor of requiring the blank + lines](http://article.gmane.org/gmane.text.markdown.general/2146).) + +3. Is a blank line needed before an indented code block? + (`Markdown.pl` requires it, but this is not mentioned in the + documentation, and some implementations do not require it.) + + ``` markdown + paragraph + code? + ``` + +4. What is the exact rule for determining when list items get + wrapped in `

` tags? Can a list be partially "loose" and partially + "tight"? What should we do with a list like this? + + ``` markdown + 1. one + + 2. two + 3. three + ``` + + Or this? + + ``` markdown + 1. one + - a + + - b + 2. two + ``` + + (There are some relevant comments by John Gruber + [here](http://article.gmane.org/gmane.text.markdown.general/2554).) + +5. Can list markers be indented? Can ordered list markers be right-aligned? + + ``` markdown + 8. item 1 + 9. item 2 + 10. item 2a + ``` + +6. Is this one list with a thematic break in its second item, + or two lists separated by a thematic break? + + ``` markdown + * a + * * * * * + * b + ``` + +7. When list markers change from numbers to bullets, do we have + two lists or one? (The Markdown syntax description suggests two, + but the perl scripts and many other implementations produce one.) + + ``` markdown + 1. fee + 2. fie + - foe + - fum + ``` + +8. What are the precedence rules for the markers of inline structure? + For example, is the following a valid link, or does the code span + take precedence ? + + ``` markdown + [a backtick (`)](/url) and [another backtick (`)](/url). + ``` + +9. What are the precedence rules for markers of emphasis and strong + emphasis? For example, how should the following be parsed? + + ``` markdown + *foo *bar* baz* + ``` + +10. What are the precedence rules between block-level and inline-level + structure? For example, how should the following be parsed? + + ``` markdown + - `a long code span can contain a hyphen like this + - and it can screw things up` + ``` + +11. Can list items include section headings? (`Markdown.pl` does not + allow this, but does allow blockquotes to include headings.) + + ``` markdown + - # Heading + ``` + +12. Can list items be empty? + + ``` markdown + * a + * + * b + ``` + +13. Can link references be defined inside block quotes or list items? + + ``` markdown + > Blockquote [foo]. + > + > [foo]: /url + ``` + +14. If there are multiple definitions for the same reference, which takes + precedence? + + ``` markdown + [foo]: /url1 + [foo]: /url2 + + [foo][] + ``` + +In the absence of a spec, early implementers consulted `Markdown.pl` +to resolve these ambiguities. But `Markdown.pl` was quite buggy, and +gave manifestly bad results in many cases, so it was not a +satisfactory replacement for a spec. + +Because there is no unambiguous spec, implementations have diverged +considerably. As a result, users are often surprised to find that +a document that renders one way on one system (say, a GitHub wiki) +renders differently on another (say, converting to docbook using +pandoc). To make matters worse, because nothing in Markdown counts +as a "syntax error," the divergence often isn't discovered right away. + +## About this document + +This document attempts to specify Markdown syntax unambiguously. +It contains many examples with side-by-side Markdown and +HTML. These are intended to double as conformance tests. An +accompanying script `spec_tests.py` can be used to run the tests +against any Markdown program: + + python test/spec_tests.py --spec spec.txt --program PROGRAM + +Since this document describes how Markdown is to be parsed into +an abstract syntax tree, it would have made sense to use an abstract +representation of the syntax tree instead of HTML. But HTML is capable +of representing the structural distinctions we need to make, and the +choice of HTML for the tests makes it possible to run the tests against +an implementation without writing an abstract syntax tree renderer. + +This document is generated from a text file, `spec.txt`, written +in Markdown with a small extension for the side-by-side tests. +The script `tools/makespec.py` can be used to convert `spec.txt` into +HTML or CommonMark (which can then be converted into other formats). + +In the examples, the `→` character is used to represent tabs. + +# Preliminaries + +## Characters and lines + +Any sequence of [characters] is a valid CommonMark +document. + +A [character](@) is a Unicode code point. Although some +code points (for example, combining accents) do not correspond to +characters in an intuitive sense, all code points count as characters +for purposes of this spec. + +This spec does not specify an encoding; it thinks of lines as composed +of [characters] rather than bytes. A conforming parser may be limited +to a certain encoding. + +A [line](@) is a sequence of zero or more [characters] +other than newline (`U+000A`) or carriage return (`U+000D`), +followed by a [line ending] or by the end of file. + +A [line ending](@) is a newline (`U+000A`), a carriage return +(`U+000D`) not followed by a newline, or a carriage return and a +following newline. + +A line containing no characters, or a line containing only spaces +(`U+0020`) or tabs (`U+0009`), is called a [blank line](@). + +The following definitions of character classes will be used in this spec: + +A [whitespace character](@) is a space +(`U+0020`), tab (`U+0009`), newline (`U+000A`), line tabulation (`U+000B`), +form feed (`U+000C`), or carriage return (`U+000D`). + +[Whitespace](@) is a sequence of one or more [whitespace +characters]. + +A [Unicode whitespace character](@) is +any code point in the Unicode `Zs` general category, or a tab (`U+0009`), +carriage return (`U+000D`), newline (`U+000A`), or form feed +(`U+000C`). + +[Unicode whitespace](@) is a sequence of one +or more [Unicode whitespace characters]. + +A [space](@) is `U+0020`. + +A [non-whitespace character](@) is any character +that is not a [whitespace character]. + +An [ASCII punctuation character](@) +is `!`, `"`, `#`, `$`, `%`, `&`, `'`, `(`, `)`, +`*`, `+`, `,`, `-`, `.`, `/` (U+0021–2F), +`:`, `;`, `<`, `=`, `>`, `?`, `@` (U+003A–0040), +`[`, `\`, `]`, `^`, `_`, `` ` `` (U+005B–0060), +`{`, `|`, `}`, or `~` (U+007B–007E). + +A [punctuation character](@) is an [ASCII +punctuation character] or anything in +the general Unicode categories `Pc`, `Pd`, `Pe`, `Pf`, `Pi`, `Po`, or `Ps`. + +## Tabs + +Tabs in lines are not expanded to [spaces]. However, +in contexts where whitespace helps to define block structure, +tabs behave as if they were replaced by spaces with a tab stop +of 4 characters. + +Thus, for example, a tab can be used instead of four spaces +in an indented code block. (Note, however, that internal +tabs are passed through as literal tabs, not expanded to +spaces.) + +```````````````````````````````` example +→foo→baz→→bim +. +

foo→baz→→bim
+
+```````````````````````````````` + +```````````````````````````````` example + →foo→baz→→bim +. +
foo→baz→→bim
+
+```````````````````````````````` + +```````````````````````````````` example + a→a + ὐ→a +. +
a→a
+ὐ→a
+
+```````````````````````````````` + +In the following example, a continuation paragraph of a list +item is indented with a tab; this has exactly the same effect +as indentation with four spaces would: + +```````````````````````````````` example + - foo + +→bar +. +
    +
  • +

    foo

    +

    bar

    +
  • +
+```````````````````````````````` + +```````````````````````````````` example +- foo + +→→bar +. +
    +
  • +

    foo

    +
      bar
    +
    +
  • +
+```````````````````````````````` + +Normally the `>` that begins a block quote may be followed +optionally by a space, which is not considered part of the +content. In the following case `>` is followed by a tab, +which is treated as if it were expanded into three spaces. +Since one of these spaces is considered part of the +delimiter, `foo` is considered to be indented six spaces +inside the block quote context, so we get an indented +code block starting with two spaces. + +```````````````````````````````` example +>→→foo +. +
+
  foo
+
+
+```````````````````````````````` + +```````````````````````````````` example +-→→foo +. +
    +
  • +
      foo
    +
    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example + foo +→bar +. +
foo
+bar
+
+```````````````````````````````` + +```````````````````````````````` example + - foo + - bar +→ - baz +. +
    +
  • foo +
      +
    • bar +
        +
      • baz
      • +
      +
    • +
    +
  • +
+```````````````````````````````` + +```````````````````````````````` example +#→Foo +. +

Foo

+```````````````````````````````` + +```````````````````````````````` example +*→*→*→ +. +
+```````````````````````````````` + + +## Insecure characters + +For security reasons, the Unicode character `U+0000` must be replaced +with the REPLACEMENT CHARACTER (`U+FFFD`). + +# Blocks and inlines + +We can think of a document as a sequence of +[blocks](@)---structural elements like paragraphs, block +quotations, lists, headings, rules, and code blocks. Some blocks (like +block quotes and list items) contain other blocks; others (like +headings and paragraphs) contain [inline](@) content---text, +links, emphasized text, images, code spans, and so on. + +## Precedence + +Indicators of block structure always take precedence over indicators +of inline structure. So, for example, the following is a list with +two items, not a list with one item containing a code span: + +```````````````````````````````` example +- `one +- two` +. +
    +
  • `one
  • +
  • two`
  • +
+```````````````````````````````` + + +This means that parsing can proceed in two steps: first, the block +structure of the document can be discerned; second, text lines inside +paragraphs, headings, and other block constructs can be parsed for inline +structure. The second step requires information about link reference +definitions that will be available only at the end of the first +step. Note that the first step requires processing lines in sequence, +but the second can be parallelized, since the inline parsing of +one block element does not affect the inline parsing of any other. + +## Container blocks and leaf blocks + +We can divide blocks into two types: +[container blocks](@), +which can contain other blocks, and [leaf blocks](@), +which cannot. + +# Leaf blocks + +This section describes the different kinds of leaf block that make up a +Markdown document. + +## Thematic breaks + +A line consisting of 0-3 spaces of indentation, followed by a sequence +of three or more matching `-`, `_`, or `*` characters, each followed +optionally by any number of spaces or tabs, forms a +[thematic break](@). + +```````````````````````````````` example +*** +--- +___ +. +
+
+
+```````````````````````````````` + + +Wrong characters: + +```````````````````````````````` example ++++ +. +

+++

+```````````````````````````````` + + +```````````````````````````````` example +=== +. +

===

+```````````````````````````````` + + +Not enough characters: + +```````````````````````````````` example +-- +** +__ +. +

-- +** +__

+```````````````````````````````` + + +One to three spaces indent are allowed: + +```````````````````````````````` example + *** + *** + *** +. +
+
+
+```````````````````````````````` + + +Four spaces is too many: + +```````````````````````````````` example + *** +. +
***
+
+```````````````````````````````` + + +```````````````````````````````` example +Foo + *** +. +

Foo +***

+```````````````````````````````` + + +More than three characters may be used: + +```````````````````````````````` example +_____________________________________ +. +
+```````````````````````````````` + + +Spaces are allowed between the characters: + +```````````````````````````````` example + - - - +. +
+```````````````````````````````` + + +```````````````````````````````` example + ** * ** * ** * ** +. +
+```````````````````````````````` + + +```````````````````````````````` example +- - - - +. +
+```````````````````````````````` + + +Spaces are allowed at the end: + +```````````````````````````````` example +- - - - +. +
+```````````````````````````````` + + +However, no other characters may occur in the line: + +```````````````````````````````` example +_ _ _ _ a + +a------ + +---a--- +. +

_ _ _ _ a

+

a------

+

---a---

+```````````````````````````````` + + +It is required that all of the [non-whitespace characters] be the same. +So, this is not a thematic break: + +```````````````````````````````` example + *-* +. +

-

+```````````````````````````````` + + +Thematic breaks do not need blank lines before or after: + +```````````````````````````````` example +- foo +*** +- bar +. +
    +
  • foo
  • +
+
+
    +
  • bar
  • +
+```````````````````````````````` + + +Thematic breaks can interrupt a paragraph: + +```````````````````````````````` example +Foo +*** +bar +. +

Foo

+
+

bar

+```````````````````````````````` + + +If a line of dashes that meets the above conditions for being a +thematic break could also be interpreted as the underline of a [setext +heading], the interpretation as a +[setext heading] takes precedence. Thus, for example, +this is a setext heading, not a paragraph followed by a thematic break: + +```````````````````````````````` example +Foo +--- +bar +. +

Foo

+

bar

+```````````````````````````````` + + +When both a thematic break and a list item are possible +interpretations of a line, the thematic break takes precedence: + +```````````````````````````````` example +* Foo +* * * +* Bar +. +
    +
  • Foo
  • +
+
+
    +
  • Bar
  • +
+```````````````````````````````` + + +If you want a thematic break in a list item, use a different bullet: + +```````````````````````````````` example +- Foo +- * * * +. +
    +
  • Foo
  • +
  • +
    +
  • +
+```````````````````````````````` + + +## ATX headings + +An [ATX heading](@) +consists of a string of characters, parsed as inline content, between an +opening sequence of 1--6 unescaped `#` characters and an optional +closing sequence of any number of unescaped `#` characters. +The opening sequence of `#` characters must be followed by a +[space] or by the end of line. The optional closing sequence of `#`s must be +preceded by a [space] and may be followed by spaces only. The opening +`#` character may be indented 0-3 spaces. The raw contents of the +heading are stripped of leading and trailing spaces before being parsed +as inline content. The heading level is equal to the number of `#` +characters in the opening sequence. + +Simple headings: + +```````````````````````````````` example +# foo +## foo +### foo +#### foo +##### foo +###### foo +. +

foo

+

foo

+

foo

+

foo

+
foo
+
foo
+```````````````````````````````` + + +More than six `#` characters is not a heading: + +```````````````````````````````` example +####### foo +. +

####### foo

+```````````````````````````````` + + +At least one space is required between the `#` characters and the +heading's contents, unless the heading is empty. Note that many +implementations currently do not require the space. However, the +space was required by the +[original ATX implementation](http://www.aaronsw.com/2002/atx/atx.py), +and it helps prevent things like the following from being parsed as +headings: + +```````````````````````````````` example +#5 bolt + +#hashtag +. +

#5 bolt

+

#hashtag

+```````````````````````````````` + + +This is not a heading, because the first `#` is escaped: + +```````````````````````````````` example +\## foo +. +

## foo

+```````````````````````````````` + + +Contents are parsed as inlines: + +```````````````````````````````` example +# foo *bar* \*baz\* +. +

foo bar *baz*

+```````````````````````````````` + + +Leading and trailing [whitespace] is ignored in parsing inline content: + +```````````````````````````````` example +# foo +. +

foo

+```````````````````````````````` + + +One to three spaces indentation are allowed: + +```````````````````````````````` example + ### foo + ## foo + # foo +. +

foo

+

foo

+

foo

+```````````````````````````````` + + +Four spaces are too much: + +```````````````````````````````` example + # foo +. +
# foo
+
+```````````````````````````````` + + +```````````````````````````````` example +foo + # bar +. +

foo +# bar

+```````````````````````````````` + + +A closing sequence of `#` characters is optional: + +```````````````````````````````` example +## foo ## + ### bar ### +. +

foo

+

bar

+```````````````````````````````` + + +It need not be the same length as the opening sequence: + +```````````````````````````````` example +# foo ################################## +##### foo ## +. +

foo

+
foo
+```````````````````````````````` + + +Spaces are allowed after the closing sequence: + +```````````````````````````````` example +### foo ### +. +

foo

+```````````````````````````````` + + +A sequence of `#` characters with anything but [spaces] following it +is not a closing sequence, but counts as part of the contents of the +heading: + +```````````````````````````````` example +### foo ### b +. +

foo ### b

+```````````````````````````````` + + +The closing sequence must be preceded by a space: + +```````````````````````````````` example +# foo# +. +

foo#

+```````````````````````````````` + + +Backslash-escaped `#` characters do not count as part +of the closing sequence: + +```````````````````````````````` example +### foo \### +## foo #\## +# foo \# +. +

foo ###

+

foo ###

+

foo #

+```````````````````````````````` + + +ATX headings need not be separated from surrounding content by blank +lines, and they can interrupt paragraphs: + +```````````````````````````````` example +**** +## foo +**** +. +
+

foo

+
+```````````````````````````````` + + +```````````````````````````````` example +Foo bar +# baz +Bar foo +. +

Foo bar

+

baz

+

Bar foo

+```````````````````````````````` + + +ATX headings can be empty: + +```````````````````````````````` example +## +# +### ### +. +

+

+

+```````````````````````````````` + + +## Setext headings + +A [setext heading](@) consists of one or more +lines of text, each containing at least one [non-whitespace +character], with no more than 3 spaces indentation, followed by +a [setext heading underline]. The lines of text must be such +that, were they not followed by the setext heading underline, +they would be interpreted as a paragraph: they cannot be +interpretable as a [code fence], [ATX heading][ATX headings], +[block quote][block quotes], [thematic break][thematic breaks], +[list item][list items], or [HTML block][HTML blocks]. + +A [setext heading underline](@) is a sequence of +`=` characters or a sequence of `-` characters, with no more than 3 +spaces indentation and any number of trailing spaces. If a line +containing a single `-` can be interpreted as an +empty [list items], it should be interpreted this way +and not as a [setext heading underline]. + +The heading is a level 1 heading if `=` characters are used in +the [setext heading underline], and a level 2 heading if `-` +characters are used. The contents of the heading are the result +of parsing the preceding lines of text as CommonMark inline +content. + +In general, a setext heading need not be preceded or followed by a +blank line. However, it cannot interrupt a paragraph, so when a +setext heading comes after a paragraph, a blank line is needed between +them. + +Simple examples: + +```````````````````````````````` example +Foo *bar* +========= + +Foo *bar* +--------- +. +

Foo bar

+

Foo bar

+```````````````````````````````` + + +The content of the header may span more than one line: + +```````````````````````````````` example +Foo *bar +baz* +==== +. +

Foo bar +baz

+```````````````````````````````` + +The contents are the result of parsing the headings's raw +content as inlines. The heading's raw content is formed by +concatenating the lines and removing initial and final +[whitespace]. + +```````````````````````````````` example + Foo *bar +baz*→ +==== +. +

Foo bar +baz

+```````````````````````````````` + + +The underlining can be any length: + +```````````````````````````````` example +Foo +------------------------- + +Foo += +. +

Foo

+

Foo

+```````````````````````````````` + + +The heading content can be indented up to three spaces, and need +not line up with the underlining: + +```````````````````````````````` example + Foo +--- + + Foo +----- + + Foo + === +. +

Foo

+

Foo

+

Foo

+```````````````````````````````` + + +Four spaces indent is too much: + +```````````````````````````````` example + Foo + --- + + Foo +--- +. +
Foo
+---
+
+Foo
+
+
+```````````````````````````````` + + +The setext heading underline can be indented up to three spaces, and +may have trailing spaces: + +```````````````````````````````` example +Foo + ---- +. +

Foo

+```````````````````````````````` + + +Four spaces is too much: + +```````````````````````````````` example +Foo + --- +. +

Foo +---

+```````````````````````````````` + + +The setext heading underline cannot contain internal spaces: + +```````````````````````````````` example +Foo += = + +Foo +--- - +. +

Foo += =

+

Foo

+
+```````````````````````````````` + + +Trailing spaces in the content line do not cause a line break: + +```````````````````````````````` example +Foo +----- +. +

Foo

+```````````````````````````````` + + +Nor does a backslash at the end: + +```````````````````````````````` example +Foo\ +---- +. +

Foo\

+```````````````````````````````` + + +Since indicators of block structure take precedence over +indicators of inline structure, the following are setext headings: + +```````````````````````````````` example +`Foo +---- +` + + +. +

`Foo

+

`

+

<a title="a lot

+

of dashes"/>

+```````````````````````````````` + + +The setext heading underline cannot be a [lazy continuation +line] in a list item or block quote: + +```````````````````````````````` example +> Foo +--- +. +
+

Foo

+
+
+```````````````````````````````` + + +```````````````````````````````` example +> foo +bar +=== +. +
+

foo +bar +===

+
+```````````````````````````````` + + +```````````````````````````````` example +- Foo +--- +. +
    +
  • Foo
  • +
+
+```````````````````````````````` + + +A blank line is needed between a paragraph and a following +setext heading, since otherwise the paragraph becomes part +of the heading's content: + +```````````````````````````````` example +Foo +Bar +--- +. +

Foo +Bar

+```````````````````````````````` + + +But in general a blank line is not required before or after +setext headings: + +```````````````````````````````` example +--- +Foo +--- +Bar +--- +Baz +. +
+

Foo

+

Bar

+

Baz

+```````````````````````````````` + + +Setext headings cannot be empty: + +```````````````````````````````` example + +==== +. +

====

+```````````````````````````````` + + +Setext heading text lines must not be interpretable as block +constructs other than paragraphs. So, the line of dashes +in these examples gets interpreted as a thematic break: + +```````````````````````````````` example +--- +--- +. +
+
+```````````````````````````````` + + +```````````````````````````````` example +- foo +----- +. +
    +
  • foo
  • +
+
+```````````````````````````````` + + +```````````````````````````````` example + foo +--- +. +
foo
+
+
+```````````````````````````````` + + +```````````````````````````````` example +> foo +----- +. +
+

foo

+
+
+```````````````````````````````` + + +If you want a heading with `> foo` as its literal text, you can +use backslash escapes: + +```````````````````````````````` example +\> foo +------ +. +

> foo

+```````````````````````````````` + + +**Compatibility note:** Most existing Markdown implementations +do not allow the text of setext headings to span multiple lines. +But there is no consensus about how to interpret + +``` markdown +Foo +bar +--- +baz +``` + +One can find four different interpretations: + +1. paragraph "Foo", heading "bar", paragraph "baz" +2. paragraph "Foo bar", thematic break, paragraph "baz" +3. paragraph "Foo bar --- baz" +4. heading "Foo bar", paragraph "baz" + +We find interpretation 4 most natural, and interpretation 4 +increases the expressive power of CommonMark, by allowing +multiline headings. Authors who want interpretation 1 can +put a blank line after the first paragraph: + +```````````````````````````````` example +Foo + +bar +--- +baz +. +

Foo

+

bar

+

baz

+```````````````````````````````` + + +Authors who want interpretation 2 can put blank lines around +the thematic break, + +```````````````````````````````` example +Foo +bar + +--- + +baz +. +

Foo +bar

+
+

baz

+```````````````````````````````` + + +or use a thematic break that cannot count as a [setext heading +underline], such as + +```````````````````````````````` example +Foo +bar +* * * +baz +. +

Foo +bar

+
+

baz

+```````````````````````````````` + + +Authors who want interpretation 3 can use backslash escapes: + +```````````````````````````````` example +Foo +bar +\--- +baz +. +

Foo +bar +--- +baz

+```````````````````````````````` + + +## Indented code blocks + +An [indented code block](@) is composed of one or more +[indented chunks] separated by blank lines. +An [indented chunk](@) is a sequence of non-blank lines, +each indented four or more spaces. The contents of the code block are +the literal contents of the lines, including trailing +[line endings], minus four spaces of indentation. +An indented code block has no [info string]. + +An indented code block cannot interrupt a paragraph, so there must be +a blank line between a paragraph and a following indented code block. +(A blank line is not needed, however, between a code block and a following +paragraph.) + +```````````````````````````````` example + a simple + indented code block +. +
a simple
+  indented code block
+
+```````````````````````````````` + + +If there is any ambiguity between an interpretation of indentation +as a code block and as indicating that material belongs to a [list +item][list items], the list item interpretation takes precedence: + +```````````````````````````````` example + - foo + + bar +. +
    +
  • +

    foo

    +

    bar

    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example +1. foo + + - bar +. +
    +
  1. +

    foo

    +
      +
    • bar
    • +
    +
  2. +
+```````````````````````````````` + + + +The contents of a code block are literal text, and do not get parsed +as Markdown: + +```````````````````````````````` example +
+ *hi* + + - one +. +
<a/>
+*hi*
+
+- one
+
+```````````````````````````````` + + +Here we have three chunks separated by blank lines: + +```````````````````````````````` example + chunk1 + + chunk2 + + + + chunk3 +. +
chunk1
+
+chunk2
+
+
+
+chunk3
+
+```````````````````````````````` + + +Any initial spaces beyond four will be included in the content, even +in interior blank lines: + +```````````````````````````````` example + chunk1 + + chunk2 +. +
chunk1
+  
+  chunk2
+
+```````````````````````````````` + + +An indented code block cannot interrupt a paragraph. (This +allows hanging indents and the like.) + +```````````````````````````````` example +Foo + bar + +. +

Foo +bar

+```````````````````````````````` + + +However, any non-blank line with fewer than four leading spaces ends +the code block immediately. So a paragraph may occur immediately +after indented code: + +```````````````````````````````` example + foo +bar +. +
foo
+
+

bar

+```````````````````````````````` + + +And indented code can occur immediately before and after other kinds of +blocks: + +```````````````````````````````` example +# Heading + foo +Heading +------ + foo +---- +. +

Heading

+
foo
+
+

Heading

+
foo
+
+
+```````````````````````````````` + + +The first line can be indented more than four spaces: + +```````````````````````````````` example + foo + bar +. +
    foo
+bar
+
+```````````````````````````````` + + +Blank lines preceding or following an indented code block +are not included in it: + +```````````````````````````````` example + + + foo + + +. +
foo
+
+```````````````````````````````` + + +Trailing spaces are included in the code block's content: + +```````````````````````````````` example + foo +. +
foo  
+
+```````````````````````````````` + + + +## Fenced code blocks + +A [code fence](@) is a sequence +of at least three consecutive backtick characters (`` ` ``) or +tildes (`~`). (Tildes and backticks cannot be mixed.) +A [fenced code block](@) +begins with a code fence, indented no more than three spaces. + +The line with the opening code fence may optionally contain some text +following the code fence; this is trimmed of leading and trailing +whitespace and called the [info string](@). If the [info string] comes +after a backtick fence, it may not contain any backtick +characters. (The reason for this restriction is that otherwise +some inline code would be incorrectly interpreted as the +beginning of a fenced code block.) + +The content of the code block consists of all subsequent lines, until +a closing [code fence] of the same type as the code block +began with (backticks or tildes), and with at least as many backticks +or tildes as the opening code fence. If the leading code fence is +indented N spaces, then up to N spaces of indentation are removed from +each line of the content (if present). (If a content line is not +indented, it is preserved unchanged. If it is indented less than N +spaces, all of the indentation is removed.) + +The closing code fence may be indented up to three spaces, and may be +followed only by spaces, which are ignored. If the end of the +containing block (or document) is reached and no closing code fence +has been found, the code block contains all of the lines after the +opening code fence until the end of the containing block (or +document). (An alternative spec would require backtracking in the +event that a closing code fence is not found. But this makes parsing +much less efficient, and there seems to be no real down side to the +behavior described here.) + +A fenced code block may interrupt a paragraph, and does not require +a blank line either before or after. + +The content of a code fence is treated as literal text, not parsed +as inlines. The first word of the [info string] is typically used to +specify the language of the code sample, and rendered in the `class` +attribute of the `code` tag. However, this spec does not mandate any +particular treatment of the [info string]. + +Here is a simple example with backticks: + +```````````````````````````````` example +``` +< + > +``` +. +
<
+ >
+
+```````````````````````````````` + + +With tildes: + +```````````````````````````````` example +~~~ +< + > +~~~ +. +
<
+ >
+
+```````````````````````````````` + +Fewer than three backticks is not enough: + +```````````````````````````````` example +`` +foo +`` +. +

foo

+```````````````````````````````` + +The closing code fence must use the same character as the opening +fence: + +```````````````````````````````` example +``` +aaa +~~~ +``` +. +
aaa
+~~~
+
+```````````````````````````````` + + +```````````````````````````````` example +~~~ +aaa +``` +~~~ +. +
aaa
+```
+
+```````````````````````````````` + + +The closing code fence must be at least as long as the opening fence: + +```````````````````````````````` example +```` +aaa +``` +`````` +. +
aaa
+```
+
+```````````````````````````````` + + +```````````````````````````````` example +~~~~ +aaa +~~~ +~~~~ +. +
aaa
+~~~
+
+```````````````````````````````` + + +Unclosed code blocks are closed by the end of the document +(or the enclosing [block quote][block quotes] or [list item][list items]): + +```````````````````````````````` example +``` +. +
+```````````````````````````````` + + +```````````````````````````````` example +````` + +``` +aaa +. +

+```
+aaa
+
+```````````````````````````````` + + +```````````````````````````````` example +> ``` +> aaa + +bbb +. +
+
aaa
+
+
+

bbb

+```````````````````````````````` + + +A code block can have all empty lines as its content: + +```````````````````````````````` example +``` + + +``` +. +

+  
+
+```````````````````````````````` + + +A code block can be empty: + +```````````````````````````````` example +``` +``` +. +
+```````````````````````````````` + + +Fences can be indented. If the opening fence is indented, +content lines will have equivalent opening indentation removed, +if present: + +```````````````````````````````` example + ``` + aaa +aaa +``` +. +
aaa
+aaa
+
+```````````````````````````````` + + +```````````````````````````````` example + ``` +aaa + aaa +aaa + ``` +. +
aaa
+aaa
+aaa
+
+```````````````````````````````` + + +```````````````````````````````` example + ``` + aaa + aaa + aaa + ``` +. +
aaa
+ aaa
+aaa
+
+```````````````````````````````` + + +Four spaces indentation produces an indented code block: + +```````````````````````````````` example + ``` + aaa + ``` +. +
```
+aaa
+```
+
+```````````````````````````````` + + +Closing fences may be indented by 0-3 spaces, and their indentation +need not match that of the opening fence: + +```````````````````````````````` example +``` +aaa + ``` +. +
aaa
+
+```````````````````````````````` + + +```````````````````````````````` example + ``` +aaa + ``` +. +
aaa
+
+```````````````````````````````` + + +This is not a closing fence, because it is indented 4 spaces: + +```````````````````````````````` example +``` +aaa + ``` +. +
aaa
+    ```
+
+```````````````````````````````` + + + +Code fences (opening and closing) cannot contain internal spaces: + +```````````````````````````````` example +``` ``` +aaa +. +

+aaa

+```````````````````````````````` + + +```````````````````````````````` example +~~~~~~ +aaa +~~~ ~~ +. +
aaa
+~~~ ~~
+
+```````````````````````````````` + + +Fenced code blocks can interrupt paragraphs, and can be followed +directly by paragraphs, without a blank line between: + +```````````````````````````````` example +foo +``` +bar +``` +baz +. +

foo

+
bar
+
+

baz

+```````````````````````````````` + + +Other blocks can also occur before and after fenced code blocks +without an intervening blank line: + +```````````````````````````````` example +foo +--- +~~~ +bar +~~~ +# baz +. +

foo

+
bar
+
+

baz

+```````````````````````````````` + + +An [info string] can be provided after the opening code fence. +Although this spec doesn't mandate any particular treatment of +the info string, the first word is typically used to specify +the language of the code block. In HTML output, the language is +normally indicated by adding a class to the `code` element consisting +of `language-` followed by the language name. + +```````````````````````````````` example +```ruby +def foo(x) + return 3 +end +``` +. +
def foo(x)
+  return 3
+end
+
+```````````````````````````````` + + +```````````````````````````````` example +~~~~ ruby startline=3 $%@#$ +def foo(x) + return 3 +end +~~~~~~~ +. +
def foo(x)
+  return 3
+end
+
+```````````````````````````````` + + +```````````````````````````````` example +````; +```` +. +
+```````````````````````````````` + + +[Info strings] for backtick code blocks cannot contain backticks: + +```````````````````````````````` example +``` aa ``` +foo +. +

aa +foo

+```````````````````````````````` + + +[Info strings] for tilde code blocks can contain backticks and tildes: + +```````````````````````````````` example +~~~ aa ``` ~~~ +foo +~~~ +. +
foo
+
+```````````````````````````````` + + +Closing code fences cannot have [info strings]: + +```````````````````````````````` example +``` +``` aaa +``` +. +
``` aaa
+
+```````````````````````````````` + + + +## HTML blocks + +An [HTML block](@) is a group of lines that is treated +as raw HTML (and will not be escaped in HTML output). + +There are seven kinds of [HTML block], which can be defined by their +start and end conditions. The block begins with a line that meets a +[start condition](@) (after up to three spaces optional indentation). +It ends with the first subsequent line that meets a matching [end +condition](@), or the last line of the document, or the last line of +the [container block](#container-blocks) containing the current HTML +block, if no line is encountered that meets the [end condition]. If +the first line meets both the [start condition] and the [end +condition], the block will contain just that line. + +1. **Start condition:** line begins with the string ``, or the end of the line.\ +**End condition:** line contains an end tag +``, ``, or `` (case-insensitive; it +need not match the start tag). + +2. **Start condition:** line begins with the string ``. + +3. **Start condition:** line begins with the string ``. + +4. **Start condition:** line begins with the string ``. + +5. **Start condition:** line begins with the string +``. + +6. **Start condition:** line begins the string `<` or ``, or +the string `/>`.\ +**End condition:** line is followed by a [blank line]. + +7. **Start condition:** line begins with a complete [open tag] +(with any [tag name] other than `script`, +`style`, or `pre`) or a complete [closing tag], +followed only by [whitespace] or the end of the line.\ +**End condition:** line is followed by a [blank line]. + +HTML blocks continue until they are closed by their appropriate +[end condition], or the last line of the document or other [container +block](#container-blocks). This means any HTML **within an HTML +block** that might otherwise be recognised as a start condition will +be ignored by the parser and passed through as-is, without changing +the parser's state. + +For instance, `
` within a HTML block started by `` will not affect
+the parser state; as the HTML block was started in by start condition 6, it
+will end at any blank line. This can be surprising:
+
+```````````````````````````````` example
+
+
+**Hello**,
+
+_world_.
+
+
+. +
+
+**Hello**,
+

world. +

+
+```````````````````````````````` + +In this case, the HTML block is terminated by the newline — the `**Hello**` +text remains verbatim — and regular parsing resumes, with a paragraph, +emphasised `world` and inline and block HTML following. + +All types of [HTML blocks] except type 7 may interrupt +a paragraph. Blocks of type 7 may not interrupt a paragraph. +(This restriction is intended to prevent unwanted interpretation +of long tags inside a wrapped paragraph as starting HTML blocks.) + +Some simple examples follow. Here are some basic HTML blocks +of type 6: + +```````````````````````````````` example + + + + +
+ hi +
+ +okay. +. + + + + +
+ hi +
+

okay.

+```````````````````````````````` + + +```````````````````````````````` example +
+*foo* +```````````````````````````````` + + +Here we have two HTML blocks with a Markdown paragraph between them: + +```````````````````````````````` example +
+ +*Markdown* + +
+. +
+

Markdown

+
+```````````````````````````````` + + +The tag on the first line can be partial, as long +as it is split where there would be whitespace: + +```````````````````````````````` example +
+
+. +
+
+```````````````````````````````` + + +```````````````````````````````` example +
+
+. +
+
+```````````````````````````````` + + +An open tag need not be closed: +```````````````````````````````` example +
+*foo* + +*bar* +. +
+*foo* +

bar

+```````````````````````````````` + + + +A partial tag need not even be completed (garbage +in, garbage out): + +```````````````````````````````` example +
+. + +```````````````````````````````` + + +```````````````````````````````` example +
+foo +
+. +
+foo +
+```````````````````````````````` + + +Everything until the next blank line or end of document +gets included in the HTML block. So, in the following +example, what looks like a Markdown code block +is actually part of the HTML block, which continues until a blank +line or the end of the document is reached: + +```````````````````````````````` example +
+``` c +int x = 33; +``` +. +
+``` c +int x = 33; +``` +```````````````````````````````` + + +To start an [HTML block] with a tag that is *not* in the +list of block-level tags in (6), you must put the tag by +itself on the first line (and it must be complete): + +```````````````````````````````` example + +*bar* + +. + +*bar* + +```````````````````````````````` + + +In type 7 blocks, the [tag name] can be anything: + +```````````````````````````````` example + +*bar* + +. + +*bar* + +```````````````````````````````` + + +```````````````````````````````` example + +*bar* + +. + +*bar* + +```````````````````````````````` + + +```````````````````````````````` example + +*bar* +. + +*bar* +```````````````````````````````` + + +These rules are designed to allow us to work with tags that +can function as either block-level or inline-level tags. +The `` tag is a nice example. We can surround content with +`` tags in three different ways. In this case, we get a raw +HTML block, because the `` tag is on a line by itself: + +```````````````````````````````` example + +*foo* + +. + +*foo* + +```````````````````````````````` + + +In this case, we get a raw HTML block that just includes +the `` tag (because it ends with the following blank +line). So the contents get interpreted as CommonMark: + +```````````````````````````````` example + + +*foo* + + +. + +

foo

+
+```````````````````````````````` + + +Finally, in this case, the `` tags are interpreted +as [raw HTML] *inside* the CommonMark paragraph. (Because +the tag is not on a line by itself, we get inline HTML +rather than an [HTML block].) + +```````````````````````````````` example +*foo* +. +

foo

+```````````````````````````````` + + +HTML tags designed to contain literal content +(`script`, `style`, `pre`), comments, processing instructions, +and declarations are treated somewhat differently. +Instead of ending at the first blank line, these blocks +end at the first line containing a corresponding end tag. +As a result, these blocks can contain blank lines: + +A pre tag (type 1): + +```````````````````````````````` example +

+import Text.HTML.TagSoup
+
+main :: IO ()
+main = print $ parseTags tags
+
+okay +. +

+import Text.HTML.TagSoup
+
+main :: IO ()
+main = print $ parseTags tags
+
+

okay

+```````````````````````````````` + + +A script tag (type 1): + +```````````````````````````````` example + +okay +. + +

okay

+```````````````````````````````` + + +A style tag (type 1): + +```````````````````````````````` example + +okay +. + +

okay

+```````````````````````````````` + + +If there is no matching end tag, the block will end at the +end of the document (or the enclosing [block quote][block quotes] +or [list item][list items]): + +```````````````````````````````` example + +*foo* +. + +

foo

+```````````````````````````````` + + +```````````````````````````````` example +*bar* +*baz* +. +*bar* +

baz

+```````````````````````````````` + + +Note that anything on the last line after the +end tag will be included in the [HTML block]: + +```````````````````````````````` example +1. *bar* +. +1. *bar* +```````````````````````````````` + + +A comment (type 2): + +```````````````````````````````` example + +okay +. + +

okay

+```````````````````````````````` + + + +A processing instruction (type 3): + +```````````````````````````````` example +'; + +?> +okay +. +'; + +?> +

okay

+```````````````````````````````` + + +A declaration (type 4): + +```````````````````````````````` example + +. + +```````````````````````````````` + + +CDATA (type 5): + +```````````````````````````````` example + +okay +. + +

okay

+```````````````````````````````` + + +The opening tag can be indented 1-3 spaces, but not 4: + +```````````````````````````````` example + + + +. + +
<!-- foo -->
+
+```````````````````````````````` + + +```````````````````````````````` example +
+ +
+. +
+
<div>
+
+```````````````````````````````` + + +An HTML block of types 1--6 can interrupt a paragraph, and need not be +preceded by a blank line. + +```````````````````````````````` example +Foo +
+bar +
+. +

Foo

+
+bar +
+```````````````````````````````` + + +However, a following blank line is needed, except at the end of +a document, and except for blocks of types 1--5, [above][HTML +block]: + +```````````````````````````````` example +
+bar +
+*foo* +. +
+bar +
+*foo* +```````````````````````````````` + + +HTML blocks of type 7 cannot interrupt a paragraph: + +```````````````````````````````` example +Foo + +baz +. +

Foo + +baz

+```````````````````````````````` + + +This rule differs from John Gruber's original Markdown syntax +specification, which says: + +> The only restrictions are that block-level HTML elements — +> e.g. `
`, ``, `
`, `

`, etc. — must be separated from +> surrounding content by blank lines, and the start and end tags of the +> block should not be indented with tabs or spaces. + +In some ways Gruber's rule is more restrictive than the one given +here: + +- It requires that an HTML block be preceded by a blank line. +- It does not allow the start tag to be indented. +- It requires a matching end tag, which it also does not allow to + be indented. + +Most Markdown implementations (including some of Gruber's own) do not +respect all of these restrictions. + +There is one respect, however, in which Gruber's rule is more liberal +than the one given here, since it allows blank lines to occur inside +an HTML block. There are two reasons for disallowing them here. +First, it removes the need to parse balanced tags, which is +expensive and can require backtracking from the end of the document +if no matching end tag is found. Second, it provides a very simple +and flexible way of including Markdown content inside HTML tags: +simply separate the Markdown from the HTML using blank lines: + +Compare: + +```````````````````````````````` example +

+ +*Emphasized* text. + +
+. +
+

Emphasized text.

+
+```````````````````````````````` + + +```````````````````````````````` example +
+*Emphasized* text. +
+. +
+*Emphasized* text. +
+```````````````````````````````` + + +Some Markdown implementations have adopted a convention of +interpreting content inside tags as text if the open tag has +the attribute `markdown=1`. The rule given above seems a simpler and +more elegant way of achieving the same expressive power, which is also +much simpler to parse. + +The main potential drawback is that one can no longer paste HTML +blocks into Markdown documents with 100% reliability. However, +*in most cases* this will work fine, because the blank lines in +HTML are usually followed by HTML block tags. For example: + +```````````````````````````````` example +
+ + + + + + + +
+Hi +
+. + + + + +
+Hi +
+```````````````````````````````` + + +There are problems, however, if the inner tags are indented +*and* separated by spaces, as then they will be interpreted as +an indented code block: + +```````````````````````````````` example + + + + + + + + +
+ Hi +
+. + + +
<td>
+  Hi
+</td>
+
+ +
+```````````````````````````````` + + +Fortunately, blank lines are usually not necessary and can be +deleted. The exception is inside `
` tags, but as described
+[above][HTML blocks], raw HTML blocks starting with `
`
+*can* contain blank lines.
+
+## Link reference definitions
+
+A [link reference definition](@)
+consists of a [link label], indented up to three spaces, followed
+by a colon (`:`), optional [whitespace] (including up to one
+[line ending]), a [link destination],
+optional [whitespace] (including up to one
+[line ending]), and an optional [link
+title], which if it is present must be separated
+from the [link destination] by [whitespace].
+No further [non-whitespace characters] may occur on the line.
+
+A [link reference definition]
+does not correspond to a structural element of a document.  Instead, it
+defines a label which can be used in [reference links]
+and reference-style [images] elsewhere in the document.  [Link
+reference definitions] can come either before or after the links that use
+them.
+
+```````````````````````````````` example
+[foo]: /url "title"
+
+[foo]
+.
+

foo

+```````````````````````````````` + + +```````````````````````````````` example + [foo]: + /url + 'the title' + +[foo] +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[Foo*bar\]]:my_(url) 'title (with parens)' + +[Foo*bar\]] +. +

Foo*bar]

+```````````````````````````````` + + +```````````````````````````````` example +[Foo bar]: + +'title' + +[Foo bar] +. +

Foo bar

+```````````````````````````````` + + +The title may extend over multiple lines: + +```````````````````````````````` example +[foo]: /url ' +title +line1 +line2 +' + +[foo] +. +

foo

+```````````````````````````````` + + +However, it may not contain a [blank line]: + +```````````````````````````````` example +[foo]: /url 'title + +with blank line' + +[foo] +. +

[foo]: /url 'title

+

with blank line'

+

[foo]

+```````````````````````````````` + + +The title may be omitted: + +```````````````````````````````` example +[foo]: +/url + +[foo] +. +

foo

+```````````````````````````````` + + +The link destination may not be omitted: + +```````````````````````````````` example +[foo]: + +[foo] +. +

[foo]:

+

[foo]

+```````````````````````````````` + + However, an empty link destination may be specified using + angle brackets: + +```````````````````````````````` example +[foo]: <> + +[foo] +. +

foo

+```````````````````````````````` + +The title must be separated from the link destination by +whitespace: + +```````````````````````````````` example +[foo]: (baz) + +[foo] +. +

[foo]: (baz)

+

[foo]

+```````````````````````````````` + + +Both title and destination can contain backslash escapes +and literal backslashes: + +```````````````````````````````` example +[foo]: /url\bar\*baz "foo\"bar\baz" + +[foo] +. +

foo

+```````````````````````````````` + + +A link can come before its corresponding definition: + +```````````````````````````````` example +[foo] + +[foo]: url +. +

foo

+```````````````````````````````` + + +If there are several matching definitions, the first one takes +precedence: + +```````````````````````````````` example +[foo] + +[foo]: first +[foo]: second +. +

foo

+```````````````````````````````` + + +As noted in the section on [Links], matching of labels is +case-insensitive (see [matches]). + +```````````````````````````````` example +[FOO]: /url + +[Foo] +. +

Foo

+```````````````````````````````` + + +```````````````````````````````` example +[ΑΓΩ]: /φου + +[αγω] +. +

αγω

+```````````````````````````````` + + +Here is a link reference definition with no corresponding link. +It contributes nothing to the document. + +```````````````````````````````` example +[foo]: /url +. +```````````````````````````````` + + +Here is another one: + +```````````````````````````````` example +[ +foo +]: /url +bar +. +

bar

+```````````````````````````````` + + +This is not a link reference definition, because there are +[non-whitespace characters] after the title: + +```````````````````````````````` example +[foo]: /url "title" ok +. +

[foo]: /url "title" ok

+```````````````````````````````` + + +This is a link reference definition, but it has no title: + +```````````````````````````````` example +[foo]: /url +"title" ok +. +

"title" ok

+```````````````````````````````` + + +This is not a link reference definition, because it is indented +four spaces: + +```````````````````````````````` example + [foo]: /url "title" + +[foo] +. +
[foo]: /url "title"
+
+

[foo]

+```````````````````````````````` + + +This is not a link reference definition, because it occurs inside +a code block: + +```````````````````````````````` example +``` +[foo]: /url +``` + +[foo] +. +
[foo]: /url
+
+

[foo]

+```````````````````````````````` + + +A [link reference definition] cannot interrupt a paragraph. + +```````````````````````````````` example +Foo +[bar]: /baz + +[bar] +. +

Foo +[bar]: /baz

+

[bar]

+```````````````````````````````` + + +However, it can directly follow other block elements, such as headings +and thematic breaks, and it need not be followed by a blank line. + +```````````````````````````````` example +# [Foo] +[foo]: /url +> bar +. +

Foo

+
+

bar

+
+```````````````````````````````` + +```````````````````````````````` example +[foo]: /url +bar +=== +[foo] +. +

bar

+

foo

+```````````````````````````````` + +```````````````````````````````` example +[foo]: /url +=== +[foo] +. +

=== +foo

+```````````````````````````````` + + +Several [link reference definitions] +can occur one after another, without intervening blank lines. + +```````````````````````````````` example +[foo]: /foo-url "foo" +[bar]: /bar-url + "bar" +[baz]: /baz-url + +[foo], +[bar], +[baz] +. +

foo, +bar, +baz

+```````````````````````````````` + + +[Link reference definitions] can occur +inside block containers, like lists and block quotations. They +affect the entire document, not just the container in which they +are defined: + +```````````````````````````````` example +[foo] + +> [foo]: /url +. +

foo

+
+
+```````````````````````````````` + + +Whether something is a [link reference definition] is +independent of whether the link reference it defines is +used in the document. Thus, for example, the following +document contains just a link reference definition, and +no visible content: + +```````````````````````````````` example +[foo]: /url +. +```````````````````````````````` + + +## Paragraphs + +A sequence of non-blank lines that cannot be interpreted as other +kinds of blocks forms a [paragraph](@). +The contents of the paragraph are the result of parsing the +paragraph's raw content as inlines. The paragraph's raw content +is formed by concatenating the lines and removing initial and final +[whitespace]. + +A simple example with two paragraphs: + +```````````````````````````````` example +aaa + +bbb +. +

aaa

+

bbb

+```````````````````````````````` + + +Paragraphs can contain multiple lines, but no blank lines: + +```````````````````````````````` example +aaa +bbb + +ccc +ddd +. +

aaa +bbb

+

ccc +ddd

+```````````````````````````````` + + +Multiple blank lines between paragraph have no effect: + +```````````````````````````````` example +aaa + + +bbb +. +

aaa

+

bbb

+```````````````````````````````` + + +Leading spaces are skipped: + +```````````````````````````````` example + aaa + bbb +. +

aaa +bbb

+```````````````````````````````` + + +Lines after the first may be indented any amount, since indented +code blocks cannot interrupt paragraphs. + +```````````````````````````````` example +aaa + bbb + ccc +. +

aaa +bbb +ccc

+```````````````````````````````` + + +However, the first line may be indented at most three spaces, +or an indented code block will be triggered: + +```````````````````````````````` example + aaa +bbb +. +

aaa +bbb

+```````````````````````````````` + + +```````````````````````````````` example + aaa +bbb +. +
aaa
+
+

bbb

+```````````````````````````````` + + +Final spaces are stripped before inline parsing, so a paragraph +that ends with two or more spaces will not end with a [hard line +break]: + +```````````````````````````````` example +aaa +bbb +. +

aaa
+bbb

+```````````````````````````````` + + +## Blank lines + +[Blank lines] between block-level elements are ignored, +except for the role they play in determining whether a [list] +is [tight] or [loose]. + +Blank lines at the beginning and end of the document are also ignored. + +```````````````````````````````` example + + +aaa + + +# aaa + + +. +

aaa

+

aaa

+```````````````````````````````` + + + +# Container blocks + +A [container block](#container-blocks) is a block that has other +blocks as its contents. There are two basic kinds of container blocks: +[block quotes] and [list items]. +[Lists] are meta-containers for [list items]. + +We define the syntax for container blocks recursively. The general +form of the definition is: + +> If X is a sequence of blocks, then the result of +> transforming X in such-and-such a way is a container of type Y +> with these blocks as its content. + +So, we explain what counts as a block quote or list item by explaining +how these can be *generated* from their contents. This should suffice +to define the syntax, although it does not give a recipe for *parsing* +these constructions. (A recipe is provided below in the section entitled +[A parsing strategy](#appendix-a-parsing-strategy).) + +## Block quotes + +A [block quote marker](@) +consists of 0-3 spaces of initial indent, plus (a) the character `>` together +with a following space, or (b) a single character `>` not followed by a space. + +The following rules define [block quotes]: + +1. **Basic case.** If a string of lines *Ls* constitute a sequence + of blocks *Bs*, then the result of prepending a [block quote + marker] to the beginning of each line in *Ls* + is a [block quote](#block-quotes) containing *Bs*. + +2. **Laziness.** If a string of lines *Ls* constitute a [block + quote](#block-quotes) with contents *Bs*, then the result of deleting + the initial [block quote marker] from one or + more lines in which the next [non-whitespace character] after the [block + quote marker] is [paragraph continuation + text] is a block quote with *Bs* as its content. + [Paragraph continuation text](@) is text + that will be parsed as part of the content of a paragraph, but does + not occur at the beginning of the paragraph. + +3. **Consecutiveness.** A document cannot contain two [block + quotes] in a row unless there is a [blank line] between them. + +Nothing else counts as a [block quote](#block-quotes). + +Here is a simple example: + +```````````````````````````````` example +> # Foo +> bar +> baz +. +
+

Foo

+

bar +baz

+
+```````````````````````````````` + + +The spaces after the `>` characters can be omitted: + +```````````````````````````````` example +># Foo +>bar +> baz +. +
+

Foo

+

bar +baz

+
+```````````````````````````````` + + +The `>` characters can be indented 1-3 spaces: + +```````````````````````````````` example + > # Foo + > bar + > baz +. +
+

Foo

+

bar +baz

+
+```````````````````````````````` + + +Four spaces gives us a code block: + +```````````````````````````````` example + > # Foo + > bar + > baz +. +
> # Foo
+> bar
+> baz
+
+```````````````````````````````` + + +The Laziness clause allows us to omit the `>` before +[paragraph continuation text]: + +```````````````````````````````` example +> # Foo +> bar +baz +. +
+

Foo

+

bar +baz

+
+```````````````````````````````` + + +A block quote can contain some lazy and some non-lazy +continuation lines: + +```````````````````````````````` example +> bar +baz +> foo +. +
+

bar +baz +foo

+
+```````````````````````````````` + + +Laziness only applies to lines that would have been continuations of +paragraphs had they been prepended with [block quote markers]. +For example, the `> ` cannot be omitted in the second line of + +``` markdown +> foo +> --- +``` + +without changing the meaning: + +```````````````````````````````` example +> foo +--- +. +
+

foo

+
+
+```````````````````````````````` + + +Similarly, if we omit the `> ` in the second line of + +``` markdown +> - foo +> - bar +``` + +then the block quote ends after the first line: + +```````````````````````````````` example +> - foo +- bar +. +
+
    +
  • foo
  • +
+
+
    +
  • bar
  • +
+```````````````````````````````` + + +For the same reason, we can't omit the `> ` in front of +subsequent lines of an indented or fenced code block: + +```````````````````````````````` example +> foo + bar +. +
+
foo
+
+
+
bar
+
+```````````````````````````````` + + +```````````````````````````````` example +> ``` +foo +``` +. +
+
+
+

foo

+
+```````````````````````````````` + + +Note that in the following case, we have a [lazy +continuation line]: + +```````````````````````````````` example +> foo + - bar +. +
+

foo +- bar

+
+```````````````````````````````` + + +To see why, note that in + +```markdown +> foo +> - bar +``` + +the `- bar` is indented too far to start a list, and can't +be an indented code block because indented code blocks cannot +interrupt paragraphs, so it is [paragraph continuation text]. + +A block quote can be empty: + +```````````````````````````````` example +> +. +
+
+```````````````````````````````` + + +```````````````````````````````` example +> +> +> +. +
+
+```````````````````````````````` + + +A block quote can have initial or final blank lines: + +```````````````````````````````` example +> +> foo +> +. +
+

foo

+
+```````````````````````````````` + + +A blank line always separates block quotes: + +```````````````````````````````` example +> foo + +> bar +. +
+

foo

+
+
+

bar

+
+```````````````````````````````` + + +(Most current Markdown implementations, including John Gruber's +original `Markdown.pl`, will parse this example as a single block quote +with two paragraphs. But it seems better to allow the author to decide +whether two block quotes or one are wanted.) + +Consecutiveness means that if we put these block quotes together, +we get a single block quote: + +```````````````````````````````` example +> foo +> bar +. +
+

foo +bar

+
+```````````````````````````````` + + +To get a block quote with two paragraphs, use: + +```````````````````````````````` example +> foo +> +> bar +. +
+

foo

+

bar

+
+```````````````````````````````` + + +Block quotes can interrupt paragraphs: + +```````````````````````````````` example +foo +> bar +. +

foo

+
+

bar

+
+```````````````````````````````` + + +In general, blank lines are not needed before or after block +quotes: + +```````````````````````````````` example +> aaa +*** +> bbb +. +
+

aaa

+
+
+
+

bbb

+
+```````````````````````````````` + + +However, because of laziness, a blank line is needed between +a block quote and a following paragraph: + +```````````````````````````````` example +> bar +baz +. +
+

bar +baz

+
+```````````````````````````````` + + +```````````````````````````````` example +> bar + +baz +. +
+

bar

+
+

baz

+```````````````````````````````` + + +```````````````````````````````` example +> bar +> +baz +. +
+

bar

+
+

baz

+```````````````````````````````` + + +It is a consequence of the Laziness rule that any number +of initial `>`s may be omitted on a continuation line of a +nested block quote: + +```````````````````````````````` example +> > > foo +bar +. +
+
+
+

foo +bar

+
+
+
+```````````````````````````````` + + +```````````````````````````````` example +>>> foo +> bar +>>baz +. +
+
+
+

foo +bar +baz

+
+
+
+```````````````````````````````` + + +When including an indented code block in a block quote, +remember that the [block quote marker] includes +both the `>` and a following space. So *five spaces* are needed after +the `>`: + +```````````````````````````````` example +> code + +> not code +. +
+
code
+
+
+
+

not code

+
+```````````````````````````````` + + + +## List items + +A [list marker](@) is a +[bullet list marker] or an [ordered list marker]. + +A [bullet list marker](@) +is a `-`, `+`, or `*` character. + +An [ordered list marker](@) +is a sequence of 1--9 arabic digits (`0-9`), followed by either a +`.` character or a `)` character. (The reason for the length +limit is that with 10 digits we start seeing integer overflows +in some browsers.) + +The following rules define [list items]: + +1. **Basic case.** If a sequence of lines *Ls* constitute a sequence of + blocks *Bs* starting with a [non-whitespace character], and *M* is a + list marker of width *W* followed by 1 ≤ *N* ≤ 4 spaces, then the result + of prepending *M* and the following spaces to the first line of + *Ls*, and indenting subsequent lines of *Ls* by *W + N* spaces, is a + list item with *Bs* as its contents. The type of the list item + (bullet or ordered) is determined by the type of its list marker. + If the list item is ordered, then it is also assigned a start + number, based on the ordered list marker. + + Exceptions: + + 1. When the first list item in a [list] interrupts + a paragraph---that is, when it starts on a line that would + otherwise count as [paragraph continuation text]---then (a) + the lines *Ls* must not begin with a blank line, and (b) if + the list item is ordered, the start number must be 1. + 2. If any line is a [thematic break][thematic breaks] then + that line is not a list item. + +For example, let *Ls* be the lines + +```````````````````````````````` example +A paragraph +with two lines. + + indented code + +> A block quote. +. +

A paragraph +with two lines.

+
indented code
+
+
+

A block quote.

+
+```````````````````````````````` + + +And let *M* be the marker `1.`, and *N* = 2. Then rule #1 says +that the following is an ordered list item with start number 1, +and the same contents as *Ls*: + +```````````````````````````````` example +1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +The most important thing to notice is that the position of +the text after the list marker determines how much indentation +is needed in subsequent blocks in the list item. If the list +marker takes up two spaces, and there are three spaces between +the list marker and the next [non-whitespace character], then blocks +must be indented five spaces in order to fall under the list +item. + +Here are some examples showing how far content must be indented to be +put under the list item: + +```````````````````````````````` example +- one + + two +. +
    +
  • one
  • +
+

two

+```````````````````````````````` + + +```````````````````````````````` example +- one + + two +. +
    +
  • +

    one

    +

    two

    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example + - one + + two +. +
    +
  • one
  • +
+
 two
+
+```````````````````````````````` + + +```````````````````````````````` example + - one + + two +. +
    +
  • +

    one

    +

    two

    +
  • +
+```````````````````````````````` + + +It is tempting to think of this in terms of columns: the continuation +blocks must be indented at least to the column of the first +[non-whitespace character] after the list marker. However, that is not quite right. +The spaces after the list marker determine how much relative indentation +is needed. Which column this indentation reaches will depend on +how the list item is embedded in other constructions, as shown by +this example: + +```````````````````````````````` example + > > 1. one +>> +>> two +. +
+
+
    +
  1. +

    one

    +

    two

    +
  2. +
+
+
+```````````````````````````````` + + +Here `two` occurs in the same column as the list marker `1.`, +but is actually contained in the list item, because there is +sufficient indentation after the last containing blockquote marker. + +The converse is also possible. In the following example, the word `two` +occurs far to the right of the initial text of the list item, `one`, but +it is not considered part of the list item, because it is not indented +far enough past the blockquote marker: + +```````````````````````````````` example +>>- one +>> + > > two +. +
+
+
    +
  • one
  • +
+

two

+
+
+```````````````````````````````` + + +Note that at least one space is needed between the list marker and +any following content, so these are not list items: + +```````````````````````````````` example +-one + +2.two +. +

-one

+

2.two

+```````````````````````````````` + + +A list item may contain blocks that are separated by more than +one blank line. + +```````````````````````````````` example +- foo + + + bar +. +
    +
  • +

    foo

    +

    bar

    +
  • +
+```````````````````````````````` + + +A list item may contain any kind of block: + +```````````````````````````````` example +1. foo + + ``` + bar + ``` + + baz + + > bam +. +
    +
  1. +

    foo

    +
    bar
    +
    +

    baz

    +
    +

    bam

    +
    +
  2. +
+```````````````````````````````` + + +A list item that contains an indented code block will preserve +empty lines within the code block verbatim. + +```````````````````````````````` example +- Foo + + bar + + + baz +. +
    +
  • +

    Foo

    +
    bar
    +
    +
    +baz
    +
    +
  • +
+```````````````````````````````` + +Note that ordered list start numbers must be nine digits or less: + +```````````````````````````````` example +123456789. ok +. +
    +
  1. ok
  2. +
+```````````````````````````````` + + +```````````````````````````````` example +1234567890. not ok +. +

1234567890. not ok

+```````````````````````````````` + + +A start number may begin with 0s: + +```````````````````````````````` example +0. ok +. +
    +
  1. ok
  2. +
+```````````````````````````````` + + +```````````````````````````````` example +003. ok +. +
    +
  1. ok
  2. +
+```````````````````````````````` + + +A start number may not be negative: + +```````````````````````````````` example +-1. not ok +. +

-1. not ok

+```````````````````````````````` + + + +2. **Item starting with indented code.** If a sequence of lines *Ls* + constitute a sequence of blocks *Bs* starting with an indented code + block, and *M* is a list marker of width *W* followed by + one space, then the result of prepending *M* and the following + space to the first line of *Ls*, and indenting subsequent lines of + *Ls* by *W + 1* spaces, is a list item with *Bs* as its contents. + If a line is empty, then it need not be indented. The type of the + list item (bullet or ordered) is determined by the type of its list + marker. If the list item is ordered, then it is also assigned a + start number, based on the ordered list marker. + +An indented code block will have to be indented four spaces beyond +the edge of the region where text will be included in the list item. +In the following case that is 6 spaces: + +```````````````````````````````` example +- foo + + bar +. +
    +
  • +

    foo

    +
    bar
    +
    +
  • +
+```````````````````````````````` + + +And in this case it is 11 spaces: + +```````````````````````````````` example + 10. foo + + bar +. +
    +
  1. +

    foo

    +
    bar
    +
    +
  2. +
+```````````````````````````````` + + +If the *first* block in the list item is an indented code block, +then by rule #2, the contents must be indented *one* space after the +list marker: + +```````````````````````````````` example + indented code + +paragraph + + more code +. +
indented code
+
+

paragraph

+
more code
+
+```````````````````````````````` + + +```````````````````````````````` example +1. indented code + + paragraph + + more code +. +
    +
  1. +
    indented code
    +
    +

    paragraph

    +
    more code
    +
    +
  2. +
+```````````````````````````````` + + +Note that an additional space indent is interpreted as space +inside the code block: + +```````````````````````````````` example +1. indented code + + paragraph + + more code +. +
    +
  1. +
     indented code
    +
    +

    paragraph

    +
    more code
    +
    +
  2. +
+```````````````````````````````` + + +Note that rules #1 and #2 only apply to two cases: (a) cases +in which the lines to be included in a list item begin with a +[non-whitespace character], and (b) cases in which +they begin with an indented code +block. In a case like the following, where the first block begins with +a three-space indent, the rules do not allow us to form a list item by +indenting the whole thing and prepending a list marker: + +```````````````````````````````` example + foo + +bar +. +

foo

+

bar

+```````````````````````````````` + + +```````````````````````````````` example +- foo + + bar +. +
    +
  • foo
  • +
+

bar

+```````````````````````````````` + + +This is not a significant restriction, because when a block begins +with 1-3 spaces indent, the indentation can always be removed without +a change in interpretation, allowing rule #1 to be applied. So, in +the above case: + +```````````````````````````````` example +- foo + + bar +. +
    +
  • +

    foo

    +

    bar

    +
  • +
+```````````````````````````````` + + +3. **Item starting with a blank line.** If a sequence of lines *Ls* + starting with a single [blank line] constitute a (possibly empty) + sequence of blocks *Bs*, not separated from each other by more than + one blank line, and *M* is a list marker of width *W*, + then the result of prepending *M* to the first line of *Ls*, and + indenting subsequent lines of *Ls* by *W + 1* spaces, is a list + item with *Bs* as its contents. + If a line is empty, then it need not be indented. The type of the + list item (bullet or ordered) is determined by the type of its list + marker. If the list item is ordered, then it is also assigned a + start number, based on the ordered list marker. + +Here are some list items that start with a blank line but are not empty: + +```````````````````````````````` example +- + foo +- + ``` + bar + ``` +- + baz +. +
    +
  • foo
  • +
  • +
    bar
    +
    +
  • +
  • +
    baz
    +
    +
  • +
+```````````````````````````````` + +When the list item starts with a blank line, the number of spaces +following the list marker doesn't change the required indentation: + +```````````````````````````````` example +- + foo +. +
    +
  • foo
  • +
+```````````````````````````````` + + +A list item can begin with at most one blank line. +In the following example, `foo` is not part of the list +item: + +```````````````````````````````` example +- + + foo +. +
    +
  • +
+

foo

+```````````````````````````````` + + +Here is an empty bullet list item: + +```````````````````````````````` example +- foo +- +- bar +. +
    +
  • foo
  • +
  • +
  • bar
  • +
+```````````````````````````````` + + +It does not matter whether there are spaces following the [list marker]: + +```````````````````````````````` example +- foo +- +- bar +. +
    +
  • foo
  • +
  • +
  • bar
  • +
+```````````````````````````````` + + +Here is an empty ordered list item: + +```````````````````````````````` example +1. foo +2. +3. bar +. +
    +
  1. foo
  2. +
  3. +
  4. bar
  5. +
+```````````````````````````````` + + +A list may start or end with an empty list item: + +```````````````````````````````` example +* +. +
    +
  • +
+```````````````````````````````` + +However, an empty list item cannot interrupt a paragraph: + +```````````````````````````````` example +foo +* + +foo +1. +. +

foo +*

+

foo +1.

+```````````````````````````````` + + +4. **Indentation.** If a sequence of lines *Ls* constitutes a list item + according to rule #1, #2, or #3, then the result of indenting each line + of *Ls* by 1-3 spaces (the same for each line) also constitutes a + list item with the same contents and attributes. If a line is + empty, then it need not be indented. + +Indented one space: + +```````````````````````````````` example + 1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +Indented two spaces: + +```````````````````````````````` example + 1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +Indented three spaces: + +```````````````````````````````` example + 1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +Four spaces indent gives a code block: + +```````````````````````````````` example + 1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
1.  A paragraph
+    with two lines.
+
+        indented code
+
+    > A block quote.
+
+```````````````````````````````` + + + +5. **Laziness.** If a string of lines *Ls* constitute a [list + item](#list-items) with contents *Bs*, then the result of deleting + some or all of the indentation from one or more lines in which the + next [non-whitespace character] after the indentation is + [paragraph continuation text] is a + list item with the same contents and attributes. The unindented + lines are called + [lazy continuation line](@)s. + +Here is an example with [lazy continuation lines]: + +```````````````````````````````` example + 1. A paragraph +with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +Indentation can be partially deleted: + +```````````````````````````````` example + 1. A paragraph + with two lines. +. +
    +
  1. A paragraph +with two lines.
  2. +
+```````````````````````````````` + + +These examples show how laziness can work in nested structures: + +```````````````````````````````` example +> 1. > Blockquote +continued here. +. +
+
    +
  1. +
    +

    Blockquote +continued here.

    +
    +
  2. +
+
+```````````````````````````````` + + +```````````````````````````````` example +> 1. > Blockquote +> continued here. +. +
+
    +
  1. +
    +

    Blockquote +continued here.

    +
    +
  2. +
+
+```````````````````````````````` + + + +6. **That's all.** Nothing that is not counted as a list item by rules + #1--5 counts as a [list item](#list-items). + +The rules for sublists follow from the general rules +[above][List items]. A sublist must be indented the same number +of spaces a paragraph would need to be in order to be included +in the list item. + +So, in this case we need two spaces indent: + +```````````````````````````````` example +- foo + - bar + - baz + - boo +. +
    +
  • foo +
      +
    • bar +
        +
      • baz +
          +
        • boo
        • +
        +
      • +
      +
    • +
    +
  • +
+```````````````````````````````` + + +One is not enough: + +```````````````````````````````` example +- foo + - bar + - baz + - boo +. +
    +
  • foo
  • +
  • bar
  • +
  • baz
  • +
  • boo
  • +
+```````````````````````````````` + + +Here we need four, because the list marker is wider: + +```````````````````````````````` example +10) foo + - bar +. +
    +
  1. foo +
      +
    • bar
    • +
    +
  2. +
+```````````````````````````````` + + +Three is not enough: + +```````````````````````````````` example +10) foo + - bar +. +
    +
  1. foo
  2. +
+
    +
  • bar
  • +
+```````````````````````````````` + + +A list may be the first block in a list item: + +```````````````````````````````` example +- - foo +. +
    +
  • +
      +
    • foo
    • +
    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example +1. - 2. foo +. +
    +
  1. +
      +
    • +
        +
      1. foo
      2. +
      +
    • +
    +
  2. +
+```````````````````````````````` + + +A list item can contain a heading: + +```````````````````````````````` example +- # Foo +- Bar + --- + baz +. +
    +
  • +

    Foo

    +
  • +
  • +

    Bar

    +baz
  • +
+```````````````````````````````` + + +### Motivation + +John Gruber's Markdown spec says the following about list items: + +1. "List markers typically start at the left margin, but may be indented + by up to three spaces. List markers must be followed by one or more + spaces or a tab." + +2. "To make lists look nice, you can wrap items with hanging indents.... + But if you don't want to, you don't have to." + +3. "List items may consist of multiple paragraphs. Each subsequent + paragraph in a list item must be indented by either 4 spaces or one + tab." + +4. "It looks nice if you indent every line of the subsequent paragraphs, + but here again, Markdown will allow you to be lazy." + +5. "To put a blockquote within a list item, the blockquote's `>` + delimiters need to be indented." + +6. "To put a code block within a list item, the code block needs to be + indented twice — 8 spaces or two tabs." + +These rules specify that a paragraph under a list item must be indented +four spaces (presumably, from the left margin, rather than the start of +the list marker, but this is not said), and that code under a list item +must be indented eight spaces instead of the usual four. They also say +that a block quote must be indented, but not by how much; however, the +example given has four spaces indentation. Although nothing is said +about other kinds of block-level content, it is certainly reasonable to +infer that *all* block elements under a list item, including other +lists, must be indented four spaces. This principle has been called the +*four-space rule*. + +The four-space rule is clear and principled, and if the reference +implementation `Markdown.pl` had followed it, it probably would have +become the standard. However, `Markdown.pl` allowed paragraphs and +sublists to start with only two spaces indentation, at least on the +outer level. Worse, its behavior was inconsistent: a sublist of an +outer-level list needed two spaces indentation, but a sublist of this +sublist needed three spaces. It is not surprising, then, that different +implementations of Markdown have developed very different rules for +determining what comes under a list item. (Pandoc and python-Markdown, +for example, stuck with Gruber's syntax description and the four-space +rule, while discount, redcarpet, marked, PHP Markdown, and others +followed `Markdown.pl`'s behavior more closely.) + +Unfortunately, given the divergences between implementations, there +is no way to give a spec for list items that will be guaranteed not +to break any existing documents. However, the spec given here should +correctly handle lists formatted with either the four-space rule or +the more forgiving `Markdown.pl` behavior, provided they are laid out +in a way that is natural for a human to read. + +The strategy here is to let the width and indentation of the list marker +determine the indentation necessary for blocks to fall under the list +item, rather than having a fixed and arbitrary number. The writer can +think of the body of the list item as a unit which gets indented to the +right enough to fit the list marker (and any indentation on the list +marker). (The laziness rule, #5, then allows continuation lines to be +unindented if needed.) + +This rule is superior, we claim, to any rule requiring a fixed level of +indentation from the margin. The four-space rule is clear but +unnatural. It is quite unintuitive that + +``` markdown +- foo + + bar + + - baz +``` + +should be parsed as two lists with an intervening paragraph, + +``` html +
    +
  • foo
  • +
+

bar

+
    +
  • baz
  • +
+``` + +as the four-space rule demands, rather than a single list, + +``` html +
    +
  • +

    foo

    +

    bar

    +
      +
    • baz
    • +
    +
  • +
+``` + +The choice of four spaces is arbitrary. It can be learned, but it is +not likely to be guessed, and it trips up beginners regularly. + +Would it help to adopt a two-space rule? The problem is that such +a rule, together with the rule allowing 1--3 spaces indentation of the +initial list marker, allows text that is indented *less than* the +original list marker to be included in the list item. For example, +`Markdown.pl` parses + +``` markdown + - one + + two +``` + +as a single list item, with `two` a continuation paragraph: + +``` html +
    +
  • +

    one

    +

    two

    +
  • +
+``` + +and similarly + +``` markdown +> - one +> +> two +``` + +as + +``` html +
+
    +
  • +

    one

    +

    two

    +
  • +
+
+``` + +This is extremely unintuitive. + +Rather than requiring a fixed indent from the margin, we could require +a fixed indent (say, two spaces, or even one space) from the list marker (which +may itself be indented). This proposal would remove the last anomaly +discussed. Unlike the spec presented above, it would count the following +as a list item with a subparagraph, even though the paragraph `bar` +is not indented as far as the first paragraph `foo`: + +``` markdown + 10. foo + + bar +``` + +Arguably this text does read like a list item with `bar` as a subparagraph, +which may count in favor of the proposal. However, on this proposal indented +code would have to be indented six spaces after the list marker. And this +would break a lot of existing Markdown, which has the pattern: + +``` markdown +1. foo + + indented code +``` + +where the code is indented eight spaces. The spec above, by contrast, will +parse this text as expected, since the code block's indentation is measured +from the beginning of `foo`. + +The one case that needs special treatment is a list item that *starts* +with indented code. How much indentation is required in that case, since +we don't have a "first paragraph" to measure from? Rule #2 simply stipulates +that in such cases, we require one space indentation from the list marker +(and then the normal four spaces for the indented code). This will match the +four-space rule in cases where the list marker plus its initial indentation +takes four spaces (a common case), but diverge in other cases. + +## Lists + +A [list](@) is a sequence of one or more +list items [of the same type]. The list items +may be separated by any number of blank lines. + +Two list items are [of the same type](@) +if they begin with a [list marker] of the same type. +Two list markers are of the +same type if (a) they are bullet list markers using the same character +(`-`, `+`, or `*`) or (b) they are ordered list numbers with the same +delimiter (either `.` or `)`). + +A list is an [ordered list](@) +if its constituent list items begin with +[ordered list markers], and a +[bullet list](@) if its constituent list +items begin with [bullet list markers]. + +The [start number](@) +of an [ordered list] is determined by the list number of +its initial list item. The numbers of subsequent list items are +disregarded. + +A list is [loose](@) if any of its constituent +list items are separated by blank lines, or if any of its constituent +list items directly contain two block-level elements with a blank line +between them. Otherwise a list is [tight](@). +(The difference in HTML output is that paragraphs in a loose list are +wrapped in `

` tags, while paragraphs in a tight list are not.) + +Changing the bullet or ordered list delimiter starts a new list: + +```````````````````````````````` example +- foo +- bar ++ baz +. +

    +
  • foo
  • +
  • bar
  • +
+
    +
  • baz
  • +
+```````````````````````````````` + + +```````````````````````````````` example +1. foo +2. bar +3) baz +. +
    +
  1. foo
  2. +
  3. bar
  4. +
+
    +
  1. baz
  2. +
+```````````````````````````````` + + +In CommonMark, a list can interrupt a paragraph. That is, +no blank line is needed to separate a paragraph from a following +list: + +```````````````````````````````` example +Foo +- bar +- baz +. +

Foo

+
    +
  • bar
  • +
  • baz
  • +
+```````````````````````````````` + +`Markdown.pl` does not allow this, through fear of triggering a list +via a numeral in a hard-wrapped line: + +``` markdown +The number of windows in my house is +14. The number of doors is 6. +``` + +Oddly, though, `Markdown.pl` *does* allow a blockquote to +interrupt a paragraph, even though the same considerations might +apply. + +In CommonMark, we do allow lists to interrupt paragraphs, for +two reasons. First, it is natural and not uncommon for people +to start lists without blank lines: + +``` markdown +I need to buy +- new shoes +- a coat +- a plane ticket +``` + +Second, we are attracted to a + +> [principle of uniformity](@): +> if a chunk of text has a certain +> meaning, it will continue to have the same meaning when put into a +> container block (such as a list item or blockquote). + +(Indeed, the spec for [list items] and [block quotes] presupposes +this principle.) This principle implies that if + +``` markdown + * I need to buy + - new shoes + - a coat + - a plane ticket +``` + +is a list item containing a paragraph followed by a nested sublist, +as all Markdown implementations agree it is (though the paragraph +may be rendered without `

` tags, since the list is "tight"), +then + +``` markdown +I need to buy +- new shoes +- a coat +- a plane ticket +``` + +by itself should be a paragraph followed by a nested sublist. + +Since it is well established Markdown practice to allow lists to +interrupt paragraphs inside list items, the [principle of +uniformity] requires us to allow this outside list items as +well. ([reStructuredText](http://docutils.sourceforge.net/rst.html) +takes a different approach, requiring blank lines before lists +even inside other list items.) + +In order to solve of unwanted lists in paragraphs with +hard-wrapped numerals, we allow only lists starting with `1` to +interrupt paragraphs. Thus, + +```````````````````````````````` example +The number of windows in my house is +14. The number of doors is 6. +. +

The number of windows in my house is +14. The number of doors is 6.

+```````````````````````````````` + +We may still get an unintended result in cases like + +```````````````````````````````` example +The number of windows in my house is +1. The number of doors is 6. +. +

The number of windows in my house is

+
    +
  1. The number of doors is 6.
  2. +
+```````````````````````````````` + +but this rule should prevent most spurious list captures. + +There can be any number of blank lines between items: + +```````````````````````````````` example +- foo + +- bar + + +- baz +. +
    +
  • +

    foo

    +
  • +
  • +

    bar

    +
  • +
  • +

    baz

    +
  • +
+```````````````````````````````` + +```````````````````````````````` example +- foo + - bar + - baz + + + bim +. +
    +
  • foo +
      +
    • bar +
        +
      • +

        baz

        +

        bim

        +
      • +
      +
    • +
    +
  • +
+```````````````````````````````` + + +To separate consecutive lists of the same type, or to separate a +list from an indented code block that would otherwise be parsed +as a subparagraph of the final list item, you can insert a blank HTML +comment: + +```````````````````````````````` example +- foo +- bar + + + +- baz +- bim +. +
    +
  • foo
  • +
  • bar
  • +
+ +
    +
  • baz
  • +
  • bim
  • +
+```````````````````````````````` + + +```````````````````````````````` example +- foo + + notcode + +- foo + + + + code +. +
    +
  • +

    foo

    +

    notcode

    +
  • +
  • +

    foo

    +
  • +
+ +
code
+
+```````````````````````````````` + + +List items need not be indented to the same level. The following +list items will be treated as items at the same list level, +since none is indented enough to belong to the previous list +item: + +```````````````````````````````` example +- a + - b + - c + - d + - e + - f +- g +. +
    +
  • a
  • +
  • b
  • +
  • c
  • +
  • d
  • +
  • e
  • +
  • f
  • +
  • g
  • +
+```````````````````````````````` + + +```````````````````````````````` example +1. a + + 2. b + + 3. c +. +
    +
  1. +

    a

    +
  2. +
  3. +

    b

    +
  4. +
  5. +

    c

    +
  6. +
+```````````````````````````````` + +Note, however, that list items may not be indented more than +three spaces. Here `- e` is treated as a paragraph continuation +line, because it is indented more than three spaces: + +```````````````````````````````` example +- a + - b + - c + - d + - e +. +
    +
  • a
  • +
  • b
  • +
  • c
  • +
  • d +- e
  • +
+```````````````````````````````` + +And here, `3. c` is treated as in indented code block, +because it is indented four spaces and preceded by a +blank line. + +```````````````````````````````` example +1. a + + 2. b + + 3. c +. +
    +
  1. +

    a

    +
  2. +
  3. +

    b

    +
  4. +
+
3. c
+
+```````````````````````````````` + + +This is a loose list, because there is a blank line between +two of the list items: + +```````````````````````````````` example +- a +- b + +- c +. +
    +
  • +

    a

    +
  • +
  • +

    b

    +
  • +
  • +

    c

    +
  • +
+```````````````````````````````` + + +So is this, with a empty second item: + +```````````````````````````````` example +* a +* + +* c +. +
    +
  • +

    a

    +
  • +
  • +
  • +

    c

    +
  • +
+```````````````````````````````` + + +These are loose lists, even though there is no space between the items, +because one of the items directly contains two block-level elements +with a blank line between them: + +```````````````````````````````` example +- a +- b + + c +- d +. +
    +
  • +

    a

    +
  • +
  • +

    b

    +

    c

    +
  • +
  • +

    d

    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example +- a +- b + + [ref]: /url +- d +. +
    +
  • +

    a

    +
  • +
  • +

    b

    +
  • +
  • +

    d

    +
  • +
+```````````````````````````````` + + +This is a tight list, because the blank lines are in a code block: + +```````````````````````````````` example +- a +- ``` + b + + + ``` +- c +. +
    +
  • a
  • +
  • +
    b
    +
    +
    +
    +
  • +
  • c
  • +
+```````````````````````````````` + + +This is a tight list, because the blank line is between two +paragraphs of a sublist. So the sublist is loose while +the outer list is tight: + +```````````````````````````````` example +- a + - b + + c +- d +. +
    +
  • a +
      +
    • +

      b

      +

      c

      +
    • +
    +
  • +
  • d
  • +
+```````````````````````````````` + + +This is a tight list, because the blank line is inside the +block quote: + +```````````````````````````````` example +* a + > b + > +* c +. +
    +
  • a +
    +

    b

    +
    +
  • +
  • c
  • +
+```````````````````````````````` + + +This list is tight, because the consecutive block elements +are not separated by blank lines: + +```````````````````````````````` example +- a + > b + ``` + c + ``` +- d +. +
    +
  • a +
    +

    b

    +
    +
    c
    +
    +
  • +
  • d
  • +
+```````````````````````````````` + + +A single-paragraph list is tight: + +```````````````````````````````` example +- a +. +
    +
  • a
  • +
+```````````````````````````````` + + +```````````````````````````````` example +- a + - b +. +
    +
  • a +
      +
    • b
    • +
    +
  • +
+```````````````````````````````` + + +This list is loose, because of the blank line between the +two block elements in the list item: + +```````````````````````````````` example +1. ``` + foo + ``` + + bar +. +
    +
  1. +
    foo
    +
    +

    bar

    +
  2. +
+```````````````````````````````` + + +Here the outer list is loose, the inner list tight: + +```````````````````````````````` example +* foo + * bar + + baz +. +
    +
  • +

    foo

    +
      +
    • bar
    • +
    +

    baz

    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example +- a + - b + - c + +- d + - e + - f +. +
    +
  • +

    a

    +
      +
    • b
    • +
    • c
    • +
    +
  • +
  • +

    d

    +
      +
    • e
    • +
    • f
    • +
    +
  • +
+```````````````````````````````` + + +# Inlines + +Inlines are parsed sequentially from the beginning of the character +stream to the end (left to right, in left-to-right languages). +Thus, for example, in + +```````````````````````````````` example +`hi`lo` +. +

hilo`

+```````````````````````````````` + +`hi` is parsed as code, leaving the backtick at the end as a literal +backtick. + + +## Backslash escapes + +Any ASCII punctuation character may be backslash-escaped: + +```````````````````````````````` example +\!\"\#\$\%\&\'\(\)\*\+\,\-\.\/\:\;\<\=\>\?\@\[\\\]\^\_\`\{\|\}\~ +. +

!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~

+```````````````````````````````` + + +Backslashes before other characters are treated as literal +backslashes: + +```````````````````````````````` example +\→\A\a\ \3\φ\« +. +

\→\A\a\ \3\φ\«

+```````````````````````````````` + + +Escaped characters are treated as regular characters and do +not have their usual Markdown meanings: + +```````````````````````````````` example +\*not emphasized* +\
not a tag +\[not a link](/foo) +\`not code` +1\. not a list +\* not a list +\# not a heading +\[foo]: /url "not a reference" +\ö not a character entity +. +

*not emphasized* +<br/> not a tag +[not a link](/foo) +`not code` +1. not a list +* not a list +# not a heading +[foo]: /url "not a reference" +&ouml; not a character entity

+```````````````````````````````` + + +If a backslash is itself escaped, the following character is not: + +```````````````````````````````` example +\\*emphasis* +. +

\emphasis

+```````````````````````````````` + + +A backslash at the end of the line is a [hard line break]: + +```````````````````````````````` example +foo\ +bar +. +

foo
+bar

+```````````````````````````````` + + +Backslash escapes do not work in code blocks, code spans, autolinks, or +raw HTML: + +```````````````````````````````` example +`` \[\` `` +. +

\[\`

+```````````````````````````````` + + +```````````````````````````````` example + \[\] +. +
\[\]
+
+```````````````````````````````` + + +```````````````````````````````` example +~~~ +\[\] +~~~ +. +
\[\]
+
+```````````````````````````````` + + +```````````````````````````````` example + +. +

http://example.com?find=\*

+```````````````````````````````` + + +```````````````````````````````` example + +. + +```````````````````````````````` + + +But they work in all other contexts, including URLs and link titles, +link references, and [info strings] in [fenced code blocks]: + +```````````````````````````````` example +[foo](/bar\* "ti\*tle") +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[foo] + +[foo]: /bar\* "ti\*tle" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +``` foo\+bar +foo +``` +. +
foo
+
+```````````````````````````````` + + + +## Entity and numeric character references + +Valid HTML entity references and numeric character references +can be used in place of the corresponding Unicode character, +with the following exceptions: + +- Entity and character references are not recognized in code + blocks and code spans. + +- Entity and character references cannot stand in place of + special characters that define structural elements in + CommonMark. For example, although `*` can be used + in place of a literal `*` character, `*` cannot replace + `*` in emphasis delimiters, bullet list markers, or thematic + breaks. + +Conforming CommonMark parsers need not store information about +whether a particular character was represented in the source +using a Unicode character or an entity reference. + +[Entity references](@) consist of `&` + any of the valid +HTML5 entity names + `;`. The +document +is used as an authoritative source for the valid entity +references and their corresponding code points. + +```````````````````````````````` example +  & © Æ Ď +¾ ℋ ⅆ +∲ ≧̸ +. +

  & © Æ Ď +¾ ℋ ⅆ +∲ ≧̸

+```````````````````````````````` + + +[Decimal numeric character +references](@) +consist of `&#` + a string of 1--7 arabic digits + `;`. A +numeric character reference is parsed as the corresponding +Unicode character. Invalid Unicode code points will be replaced by +the REPLACEMENT CHARACTER (`U+FFFD`). For security reasons, +the code point `U+0000` will also be replaced by `U+FFFD`. + +```````````````````````````````` example +# Ӓ Ϡ � +. +

# Ӓ Ϡ �

+```````````````````````````````` + + +[Hexadecimal numeric character +references](@) consist of `&#` + +either `X` or `x` + a string of 1-6 hexadecimal digits + `;`. +They too are parsed as the corresponding Unicode character (this +time specified with a hexadecimal numeral instead of decimal). + +```````````````````````````````` example +" ആ ಫ +. +

" ആ ಫ

+```````````````````````````````` + + +Here are some nonentities: + +```````````````````````````````` example +  &x; &#; &#x; +� +&#abcdef0; +&ThisIsNotDefined; &hi?; +. +

&nbsp &x; &#; &#x; +&#87654321; +&#abcdef0; +&ThisIsNotDefined; &hi?;

+```````````````````````````````` + + +Although HTML5 does accept some entity references +without a trailing semicolon (such as `©`), these are not +recognized here, because it makes the grammar too ambiguous: + +```````````````````````````````` example +© +. +

&copy

+```````````````````````````````` + + +Strings that are not on the list of HTML5 named entities are not +recognized as entity references either: + +```````````````````````````````` example +&MadeUpEntity; +. +

&MadeUpEntity;

+```````````````````````````````` + + +Entity and numeric character references are recognized in any +context besides code spans or code blocks, including +URLs, [link titles], and [fenced code block][] [info strings]: + +```````````````````````````````` example + +. + +```````````````````````````````` + + +```````````````````````````````` example +[foo](/föö "föö") +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[foo] + +[foo]: /föö "föö" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +``` föö +foo +``` +. +
foo
+
+```````````````````````````````` + + +Entity and numeric character references are treated as literal +text in code spans and code blocks: + +```````````````````````````````` example +`föö` +. +

f&ouml;&ouml;

+```````````````````````````````` + + +```````````````````````````````` example + föfö +. +
f&ouml;f&ouml;
+
+```````````````````````````````` + + +Entity and numeric character references cannot be used +in place of symbols indicating structure in CommonMark +documents. + +```````````````````````````````` example +*foo* +*foo* +. +

*foo* +foo

+```````````````````````````````` + +```````````````````````````````` example +* foo + +* foo +. +

* foo

+
    +
  • foo
  • +
+```````````````````````````````` + +```````````````````````````````` example +foo bar +. +

foo + +bar

+```````````````````````````````` + +```````````````````````````````` example + foo +. +

→foo

+```````````````````````````````` + + +```````````````````````````````` example +[a](url "tit") +. +

[a](url "tit")

+```````````````````````````````` + + +## Code spans + +A [backtick string](@) +is a string of one or more backtick characters (`` ` ``) that is neither +preceded nor followed by a backtick. + +A [code span](@) begins with a backtick string and ends with +a backtick string of equal length. The contents of the code span are +the characters between the two backtick strings, normalized in the +following ways: + +- First, [line endings] are converted to [spaces]. +- If the resulting string both begins *and* ends with a [space] + character, but does not consist entirely of [space] + characters, a single [space] character is removed from the + front and back. This allows you to include code that begins + or ends with backtick characters, which must be separated by + whitespace from the opening or closing backtick strings. + +This is a simple code span: + +```````````````````````````````` example +`foo` +. +

foo

+```````````````````````````````` + + +Here two backticks are used, because the code contains a backtick. +This example also illustrates stripping of a single leading and +trailing space: + +```````````````````````````````` example +`` foo ` bar `` +. +

foo ` bar

+```````````````````````````````` + + +This example shows the motivation for stripping leading and trailing +spaces: + +```````````````````````````````` example +` `` ` +. +

``

+```````````````````````````````` + +Note that only *one* space is stripped: + +```````````````````````````````` example +` `` ` +. +

``

+```````````````````````````````` + +The stripping only happens if the space is on both +sides of the string: + +```````````````````````````````` example +` a` +. +

a

+```````````````````````````````` + +Only [spaces], and not [unicode whitespace] in general, are +stripped in this way: + +```````````````````````````````` example +` b ` +. +

 b 

+```````````````````````````````` + +No stripping occurs if the code span contains only spaces: + +```````````````````````````````` example +` ` +` ` +. +

  +

+```````````````````````````````` + + +[Line endings] are treated like spaces: + +```````````````````````````````` example +`` +foo +bar +baz +`` +. +

foo bar baz

+```````````````````````````````` + +```````````````````````````````` example +`` +foo +`` +. +

foo

+```````````````````````````````` + + +Interior spaces are not collapsed: + +```````````````````````````````` example +`foo bar +baz` +. +

foo bar baz

+```````````````````````````````` + +Note that browsers will typically collapse consecutive spaces +when rendering `` elements, so it is recommended that +the following CSS be used: + + code{white-space: pre-wrap;} + + +Note that backslash escapes do not work in code spans. All backslashes +are treated literally: + +```````````````````````````````` example +`foo\`bar` +. +

foo\bar`

+```````````````````````````````` + + +Backslash escapes are never needed, because one can always choose a +string of *n* backtick characters as delimiters, where the code does +not contain any strings of exactly *n* backtick characters. + +```````````````````````````````` example +``foo`bar`` +. +

foo`bar

+```````````````````````````````` + +```````````````````````````````` example +` foo `` bar ` +. +

foo `` bar

+```````````````````````````````` + + +Code span backticks have higher precedence than any other inline +constructs except HTML tags and autolinks. Thus, for example, this is +not parsed as emphasized text, since the second `*` is part of a code +span: + +```````````````````````````````` example +*foo`*` +. +

*foo*

+```````````````````````````````` + + +And this is not parsed as a link: + +```````````````````````````````` example +[not a `link](/foo`) +. +

[not a link](/foo)

+```````````````````````````````` + + +Code spans, HTML tags, and autolinks have the same precedence. +Thus, this is code: + +```````````````````````````````` example +`` +. +

<a href="">`

+```````````````````````````````` + + +But this is an HTML tag: + +```````````````````````````````` example +
` +. +

`

+```````````````````````````````` + + +And this is code: + +```````````````````````````````` example +`` +. +

<http://foo.bar.baz>`

+```````````````````````````````` + + +But this is an autolink: + +```````````````````````````````` example +` +. +

http://foo.bar.`baz`

+```````````````````````````````` + + +When a backtick string is not closed by a matching backtick string, +we just have literal backticks: + +```````````````````````````````` example +```foo`` +. +

```foo``

+```````````````````````````````` + + +```````````````````````````````` example +`foo +. +

`foo

+```````````````````````````````` + +The following case also illustrates the need for opening and +closing backtick strings to be equal in length: + +```````````````````````````````` example +`foo``bar`` +. +

`foobar

+```````````````````````````````` + + +## Emphasis and strong emphasis + +John Gruber's original [Markdown syntax +description](http://daringfireball.net/projects/markdown/syntax#em) says: + +> Markdown treats asterisks (`*`) and underscores (`_`) as indicators of +> emphasis. Text wrapped with one `*` or `_` will be wrapped with an HTML +> `` tag; double `*`'s or `_`'s will be wrapped with an HTML `` +> tag. + +This is enough for most users, but these rules leave much undecided, +especially when it comes to nested emphasis. The original +`Markdown.pl` test suite makes it clear that triple `***` and +`___` delimiters can be used for strong emphasis, and most +implementations have also allowed the following patterns: + +``` markdown +***strong emph*** +***strong** in emph* +***emph* in strong** +**in strong *emph*** +*in emph **strong*** +``` + +The following patterns are less widely supported, but the intent +is clear and they are useful (especially in contexts like bibliography +entries): + +``` markdown +*emph *with emph* in it* +**strong **with strong** in it** +``` + +Many implementations have also restricted intraword emphasis to +the `*` forms, to avoid unwanted emphasis in words containing +internal underscores. (It is best practice to put these in code +spans, but users often do not.) + +``` markdown +internal emphasis: foo*bar*baz +no emphasis: foo_bar_baz +``` + +The rules given below capture all of these patterns, while allowing +for efficient parsing strategies that do not backtrack. + +First, some definitions. A [delimiter run](@) is either +a sequence of one or more `*` characters that is not preceded or +followed by a non-backslash-escaped `*` character, or a sequence +of one or more `_` characters that is not preceded or followed by +a non-backslash-escaped `_` character. + +A [left-flanking delimiter run](@) is +a [delimiter run] that is (1) not followed by [Unicode whitespace], +and either (2a) not followed by a [punctuation character], or +(2b) followed by a [punctuation character] and +preceded by [Unicode whitespace] or a [punctuation character]. +For purposes of this definition, the beginning and the end of +the line count as Unicode whitespace. + +A [right-flanking delimiter run](@) is +a [delimiter run] that is (1) not preceded by [Unicode whitespace], +and either (2a) not preceded by a [punctuation character], or +(2b) preceded by a [punctuation character] and +followed by [Unicode whitespace] or a [punctuation character]. +For purposes of this definition, the beginning and the end of +the line count as Unicode whitespace. + +Here are some examples of delimiter runs. + + - left-flanking but not right-flanking: + + ``` + ***abc + _abc + **"abc" + _"abc" + ``` + + - right-flanking but not left-flanking: + + ``` + abc*** + abc_ + "abc"** + "abc"_ + ``` + + - Both left and right-flanking: + + ``` + abc***def + "abc"_"def" + ``` + + - Neither left nor right-flanking: + + ``` + abc *** def + a _ b + ``` + +(The idea of distinguishing left-flanking and right-flanking +delimiter runs based on the character before and the character +after comes from Roopesh Chander's +[vfmd](http://www.vfmd.org/vfmd-spec/specification/#procedure-for-identifying-emphasis-tags). +vfmd uses the terminology "emphasis indicator string" instead of "delimiter +run," and its rules for distinguishing left- and right-flanking runs +are a bit more complex than the ones given here.) + +The following rules define emphasis and strong emphasis: + +1. A single `*` character [can open emphasis](@) + iff (if and only if) it is part of a [left-flanking delimiter run]. + +2. A single `_` character [can open emphasis] iff + it is part of a [left-flanking delimiter run] + and either (a) not part of a [right-flanking delimiter run] + or (b) part of a [right-flanking delimiter run] + preceded by punctuation. + +3. A single `*` character [can close emphasis](@) + iff it is part of a [right-flanking delimiter run]. + +4. A single `_` character [can close emphasis] iff + it is part of a [right-flanking delimiter run] + and either (a) not part of a [left-flanking delimiter run] + or (b) part of a [left-flanking delimiter run] + followed by punctuation. + +5. A double `**` [can open strong emphasis](@) + iff it is part of a [left-flanking delimiter run]. + +6. A double `__` [can open strong emphasis] iff + it is part of a [left-flanking delimiter run] + and either (a) not part of a [right-flanking delimiter run] + or (b) part of a [right-flanking delimiter run] + preceded by punctuation. + +7. A double `**` [can close strong emphasis](@) + iff it is part of a [right-flanking delimiter run]. + +8. A double `__` [can close strong emphasis] iff + it is part of a [right-flanking delimiter run] + and either (a) not part of a [left-flanking delimiter run] + or (b) part of a [left-flanking delimiter run] + followed by punctuation. + +9. Emphasis begins with a delimiter that [can open emphasis] and ends + with a delimiter that [can close emphasis], and that uses the same + character (`_` or `*`) as the opening delimiter. The + opening and closing delimiters must belong to separate + [delimiter runs]. If one of the delimiters can both + open and close emphasis, then the sum of the lengths of the + delimiter runs containing the opening and closing delimiters + must not be a multiple of 3 unless both lengths are + multiples of 3. + +10. Strong emphasis begins with a delimiter that + [can open strong emphasis] and ends with a delimiter that + [can close strong emphasis], and that uses the same character + (`_` or `*`) as the opening delimiter. The + opening and closing delimiters must belong to separate + [delimiter runs]. If one of the delimiters can both open + and close strong emphasis, then the sum of the lengths of + the delimiter runs containing the opening and closing + delimiters must not be a multiple of 3 unless both lengths + are multiples of 3. + +11. A literal `*` character cannot occur at the beginning or end of + `*`-delimited emphasis or `**`-delimited strong emphasis, unless it + is backslash-escaped. + +12. A literal `_` character cannot occur at the beginning or end of + `_`-delimited emphasis or `__`-delimited strong emphasis, unless it + is backslash-escaped. + +Where rules 1--12 above are compatible with multiple parsings, +the following principles resolve ambiguity: + +13. The number of nestings should be minimized. Thus, for example, + an interpretation `...` is always preferred to + `...`. + +14. An interpretation `...` is always + preferred to `...`. + +15. When two potential emphasis or strong emphasis spans overlap, + so that the second begins before the first ends and ends after + the first ends, the first takes precedence. Thus, for example, + `*foo _bar* baz_` is parsed as `foo _bar baz_` rather + than `*foo bar* baz`. + +16. When there are two potential emphasis or strong emphasis spans + with the same closing delimiter, the shorter one (the one that + opens later) takes precedence. Thus, for example, + `**foo **bar baz**` is parsed as `**foo bar baz` + rather than `foo **bar baz`. + +17. Inline code spans, links, images, and HTML tags group more tightly + than emphasis. So, when there is a choice between an interpretation + that contains one of these elements and one that does not, the + former always wins. Thus, for example, `*[foo*](bar)` is + parsed as `*foo*` rather than as + `[foo](bar)`. + +These rules can be illustrated through a series of examples. + +Rule 1: + +```````````````````````````````` example +*foo bar* +. +

foo bar

+```````````````````````````````` + + +This is not emphasis, because the opening `*` is followed by +whitespace, and hence not part of a [left-flanking delimiter run]: + +```````````````````````````````` example +a * foo bar* +. +

a * foo bar*

+```````````````````````````````` + + +This is not emphasis, because the opening `*` is preceded +by an alphanumeric and followed by punctuation, and hence +not part of a [left-flanking delimiter run]: + +```````````````````````````````` example +a*"foo"* +. +

a*"foo"*

+```````````````````````````````` + + +Unicode nonbreaking spaces count as whitespace, too: + +```````````````````````````````` example +* a * +. +

* a *

+```````````````````````````````` + + +Intraword emphasis with `*` is permitted: + +```````````````````````````````` example +foo*bar* +. +

foobar

+```````````````````````````````` + + +```````````````````````````````` example +5*6*78 +. +

5678

+```````````````````````````````` + + +Rule 2: + +```````````````````````````````` example +_foo bar_ +. +

foo bar

+```````````````````````````````` + + +This is not emphasis, because the opening `_` is followed by +whitespace: + +```````````````````````````````` example +_ foo bar_ +. +

_ foo bar_

+```````````````````````````````` + + +This is not emphasis, because the opening `_` is preceded +by an alphanumeric and followed by punctuation: + +```````````````````````````````` example +a_"foo"_ +. +

a_"foo"_

+```````````````````````````````` + + +Emphasis with `_` is not allowed inside words: + +```````````````````````````````` example +foo_bar_ +. +

foo_bar_

+```````````````````````````````` + + +```````````````````````````````` example +5_6_78 +. +

5_6_78

+```````````````````````````````` + + +```````````````````````````````` example +пристаням_стремятся_ +. +

пристаням_стремятся_

+```````````````````````````````` + + +Here `_` does not generate emphasis, because the first delimiter run +is right-flanking and the second left-flanking: + +```````````````````````````````` example +aa_"bb"_cc +. +

aa_"bb"_cc

+```````````````````````````````` + + +This is emphasis, even though the opening delimiter is +both left- and right-flanking, because it is preceded by +punctuation: + +```````````````````````````````` example +foo-_(bar)_ +. +

foo-(bar)

+```````````````````````````````` + + +Rule 3: + +This is not emphasis, because the closing delimiter does +not match the opening delimiter: + +```````````````````````````````` example +_foo* +. +

_foo*

+```````````````````````````````` + + +This is not emphasis, because the closing `*` is preceded by +whitespace: + +```````````````````````````````` example +*foo bar * +. +

*foo bar *

+```````````````````````````````` + + +A newline also counts as whitespace: + +```````````````````````````````` example +*foo bar +* +. +

*foo bar +*

+```````````````````````````````` + + +This is not emphasis, because the second `*` is +preceded by punctuation and followed by an alphanumeric +(hence it is not part of a [right-flanking delimiter run]: + +```````````````````````````````` example +*(*foo) +. +

*(*foo)

+```````````````````````````````` + + +The point of this restriction is more easily appreciated +with this example: + +```````````````````````````````` example +*(*foo*)* +. +

(foo)

+```````````````````````````````` + + +Intraword emphasis with `*` is allowed: + +```````````````````````````````` example +*foo*bar +. +

foobar

+```````````````````````````````` + + + +Rule 4: + +This is not emphasis, because the closing `_` is preceded by +whitespace: + +```````````````````````````````` example +_foo bar _ +. +

_foo bar _

+```````````````````````````````` + + +This is not emphasis, because the second `_` is +preceded by punctuation and followed by an alphanumeric: + +```````````````````````````````` example +_(_foo) +. +

_(_foo)

+```````````````````````````````` + + +This is emphasis within emphasis: + +```````````````````````````````` example +_(_foo_)_ +. +

(foo)

+```````````````````````````````` + + +Intraword emphasis is disallowed for `_`: + +```````````````````````````````` example +_foo_bar +. +

_foo_bar

+```````````````````````````````` + + +```````````````````````````````` example +_пристаням_стремятся +. +

_пристаням_стремятся

+```````````````````````````````` + + +```````````````````````````````` example +_foo_bar_baz_ +. +

foo_bar_baz

+```````````````````````````````` + + +This is emphasis, even though the closing delimiter is +both left- and right-flanking, because it is followed by +punctuation: + +```````````````````````````````` example +_(bar)_. +. +

(bar).

+```````````````````````````````` + + +Rule 5: + +```````````````````````````````` example +**foo bar** +. +

foo bar

+```````````````````````````````` + + +This is not strong emphasis, because the opening delimiter is +followed by whitespace: + +```````````````````````````````` example +** foo bar** +. +

** foo bar**

+```````````````````````````````` + + +This is not strong emphasis, because the opening `**` is preceded +by an alphanumeric and followed by punctuation, and hence +not part of a [left-flanking delimiter run]: + +```````````````````````````````` example +a**"foo"** +. +

a**"foo"**

+```````````````````````````````` + + +Intraword strong emphasis with `**` is permitted: + +```````````````````````````````` example +foo**bar** +. +

foobar

+```````````````````````````````` + + +Rule 6: + +```````````````````````````````` example +__foo bar__ +. +

foo bar

+```````````````````````````````` + + +This is not strong emphasis, because the opening delimiter is +followed by whitespace: + +```````````````````````````````` example +__ foo bar__ +. +

__ foo bar__

+```````````````````````````````` + + +A newline counts as whitespace: +```````````````````````````````` example +__ +foo bar__ +. +

__ +foo bar__

+```````````````````````````````` + + +This is not strong emphasis, because the opening `__` is preceded +by an alphanumeric and followed by punctuation: + +```````````````````````````````` example +a__"foo"__ +. +

a__"foo"__

+```````````````````````````````` + + +Intraword strong emphasis is forbidden with `__`: + +```````````````````````````````` example +foo__bar__ +. +

foo__bar__

+```````````````````````````````` + + +```````````````````````````````` example +5__6__78 +. +

5__6__78

+```````````````````````````````` + + +```````````````````````````````` example +пристаням__стремятся__ +. +

пристаням__стремятся__

+```````````````````````````````` + + +```````````````````````````````` example +__foo, __bar__, baz__ +. +

foo, bar, baz

+```````````````````````````````` + + +This is strong emphasis, even though the opening delimiter is +both left- and right-flanking, because it is preceded by +punctuation: + +```````````````````````````````` example +foo-__(bar)__ +. +

foo-(bar)

+```````````````````````````````` + + + +Rule 7: + +This is not strong emphasis, because the closing delimiter is preceded +by whitespace: + +```````````````````````````````` example +**foo bar ** +. +

**foo bar **

+```````````````````````````````` + + +(Nor can it be interpreted as an emphasized `*foo bar *`, because of +Rule 11.) + +This is not strong emphasis, because the second `**` is +preceded by punctuation and followed by an alphanumeric: + +```````````````````````````````` example +**(**foo) +. +

**(**foo)

+```````````````````````````````` + + +The point of this restriction is more easily appreciated +with these examples: + +```````````````````````````````` example +*(**foo**)* +. +

(foo)

+```````````````````````````````` + + +```````````````````````````````` example +**Gomphocarpus (*Gomphocarpus physocarpus*, syn. +*Asclepias physocarpa*)** +. +

Gomphocarpus (Gomphocarpus physocarpus, syn. +Asclepias physocarpa)

+```````````````````````````````` + + +```````````````````````````````` example +**foo "*bar*" foo** +. +

foo "bar" foo

+```````````````````````````````` + + +Intraword emphasis: + +```````````````````````````````` example +**foo**bar +. +

foobar

+```````````````````````````````` + + +Rule 8: + +This is not strong emphasis, because the closing delimiter is +preceded by whitespace: + +```````````````````````````````` example +__foo bar __ +. +

__foo bar __

+```````````````````````````````` + + +This is not strong emphasis, because the second `__` is +preceded by punctuation and followed by an alphanumeric: + +```````````````````````````````` example +__(__foo) +. +

__(__foo)

+```````````````````````````````` + + +The point of this restriction is more easily appreciated +with this example: + +```````````````````````````````` example +_(__foo__)_ +. +

(foo)

+```````````````````````````````` + + +Intraword strong emphasis is forbidden with `__`: + +```````````````````````````````` example +__foo__bar +. +

__foo__bar

+```````````````````````````````` + + +```````````````````````````````` example +__пристаням__стремятся +. +

__пристаням__стремятся

+```````````````````````````````` + + +```````````````````````````````` example +__foo__bar__baz__ +. +

foo__bar__baz

+```````````````````````````````` + + +This is strong emphasis, even though the closing delimiter is +both left- and right-flanking, because it is followed by +punctuation: + +```````````````````````````````` example +__(bar)__. +. +

(bar).

+```````````````````````````````` + + +Rule 9: + +Any nonempty sequence of inline elements can be the contents of an +emphasized span. + +```````````````````````````````` example +*foo [bar](/url)* +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo +bar* +. +

foo +bar

+```````````````````````````````` + + +In particular, emphasis and strong emphasis can be nested +inside emphasis: + +```````````````````````````````` example +_foo __bar__ baz_ +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +_foo _bar_ baz_ +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +__foo_ bar_ +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo *bar** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo **bar** baz* +. +

foo bar baz

+```````````````````````````````` + +```````````````````````````````` example +*foo**bar**baz* +. +

foobarbaz

+```````````````````````````````` + +Note that in the preceding case, the interpretation + +``` markdown +

foobarbaz

+``` + + +is precluded by the condition that a delimiter that +can both open and close (like the `*` after `foo`) +cannot form emphasis if the sum of the lengths of +the delimiter runs containing the opening and +closing delimiters is a multiple of 3 unless +both lengths are multiples of 3. + + +For the same reason, we don't get two consecutive +emphasis sections in this example: + +```````````````````````````````` example +*foo**bar* +. +

foo**bar

+```````````````````````````````` + + +The same condition ensures that the following +cases are all strong emphasis nested inside +emphasis, even when the interior spaces are +omitted: + + +```````````````````````````````` example +***foo** bar* +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo **bar*** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo**bar*** +. +

foobar

+```````````````````````````````` + + +When the lengths of the interior closing and opening +delimiter runs are *both* multiples of 3, though, +they can match to create emphasis: + +```````````````````````````````` example +foo***bar***baz +. +

foobarbaz

+```````````````````````````````` + +```````````````````````````````` example +foo******bar*********baz +. +

foobar***baz

+```````````````````````````````` + + +Indefinite levels of nesting are possible: + +```````````````````````````````` example +*foo **bar *baz* bim** bop* +. +

foo bar baz bim bop

+```````````````````````````````` + + +```````````````````````````````` example +*foo [*bar*](/url)* +. +

foo bar

+```````````````````````````````` + + +There can be no empty emphasis or strong emphasis: + +```````````````````````````````` example +** is not an empty emphasis +. +

** is not an empty emphasis

+```````````````````````````````` + + +```````````````````````````````` example +**** is not an empty strong emphasis +. +

**** is not an empty strong emphasis

+```````````````````````````````` + + + +Rule 10: + +Any nonempty sequence of inline elements can be the contents of an +strongly emphasized span. + +```````````````````````````````` example +**foo [bar](/url)** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +**foo +bar** +. +

foo +bar

+```````````````````````````````` + + +In particular, emphasis and strong emphasis can be nested +inside strong emphasis: + +```````````````````````````````` example +__foo _bar_ baz__ +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +__foo __bar__ baz__ +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +____foo__ bar__ +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +**foo **bar**** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +**foo *bar* baz** +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +**foo*bar*baz** +. +

foobarbaz

+```````````````````````````````` + + +```````````````````````````````` example +***foo* bar** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +**foo *bar*** +. +

foo bar

+```````````````````````````````` + + +Indefinite levels of nesting are possible: + +```````````````````````````````` example +**foo *bar **baz** +bim* bop** +. +

foo bar baz +bim bop

+```````````````````````````````` + + +```````````````````````````````` example +**foo [*bar*](/url)** +. +

foo bar

+```````````````````````````````` + + +There can be no empty emphasis or strong emphasis: + +```````````````````````````````` example +__ is not an empty emphasis +. +

__ is not an empty emphasis

+```````````````````````````````` + + +```````````````````````````````` example +____ is not an empty strong emphasis +. +

____ is not an empty strong emphasis

+```````````````````````````````` + + + +Rule 11: + +```````````````````````````````` example +foo *** +. +

foo ***

+```````````````````````````````` + + +```````````````````````````````` example +foo *\** +. +

foo *

+```````````````````````````````` + + +```````````````````````````````` example +foo *_* +. +

foo _

+```````````````````````````````` + + +```````````````````````````````` example +foo ***** +. +

foo *****

+```````````````````````````````` + + +```````````````````````````````` example +foo **\*** +. +

foo *

+```````````````````````````````` + + +```````````````````````````````` example +foo **_** +. +

foo _

+```````````````````````````````` + + +Note that when delimiters do not match evenly, Rule 11 determines +that the excess literal `*` characters will appear outside of the +emphasis, rather than inside it: + +```````````````````````````````` example +**foo* +. +

*foo

+```````````````````````````````` + + +```````````````````````````````` example +*foo** +. +

foo*

+```````````````````````````````` + + +```````````````````````````````` example +***foo** +. +

*foo

+```````````````````````````````` + + +```````````````````````````````` example +****foo* +. +

***foo

+```````````````````````````````` + + +```````````````````````````````` example +**foo*** +. +

foo*

+```````````````````````````````` + + +```````````````````````````````` example +*foo**** +. +

foo***

+```````````````````````````````` + + + +Rule 12: + +```````````````````````````````` example +foo ___ +. +

foo ___

+```````````````````````````````` + + +```````````````````````````````` example +foo _\__ +. +

foo _

+```````````````````````````````` + + +```````````````````````````````` example +foo _*_ +. +

foo *

+```````````````````````````````` + + +```````````````````````````````` example +foo _____ +. +

foo _____

+```````````````````````````````` + + +```````````````````````````````` example +foo __\___ +. +

foo _

+```````````````````````````````` + + +```````````````````````````````` example +foo __*__ +. +

foo *

+```````````````````````````````` + + +```````````````````````````````` example +__foo_ +. +

_foo

+```````````````````````````````` + + +Note that when delimiters do not match evenly, Rule 12 determines +that the excess literal `_` characters will appear outside of the +emphasis, rather than inside it: + +```````````````````````````````` example +_foo__ +. +

foo_

+```````````````````````````````` + + +```````````````````````````````` example +___foo__ +. +

_foo

+```````````````````````````````` + + +```````````````````````````````` example +____foo_ +. +

___foo

+```````````````````````````````` + + +```````````````````````````````` example +__foo___ +. +

foo_

+```````````````````````````````` + + +```````````````````````````````` example +_foo____ +. +

foo___

+```````````````````````````````` + + +Rule 13 implies that if you want emphasis nested directly inside +emphasis, you must use different delimiters: + +```````````````````````````````` example +**foo** +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +*_foo_* +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +__foo__ +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +_*foo*_ +. +

foo

+```````````````````````````````` + + +However, strong emphasis within strong emphasis is possible without +switching delimiters: + +```````````````````````````````` example +****foo**** +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +____foo____ +. +

foo

+```````````````````````````````` + + + +Rule 13 can be applied to arbitrarily long sequences of +delimiters: + +```````````````````````````````` example +******foo****** +. +

foo

+```````````````````````````````` + + +Rule 14: + +```````````````````````````````` example +***foo*** +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +_____foo_____ +. +

foo

+```````````````````````````````` + + +Rule 15: + +```````````````````````````````` example +*foo _bar* baz_ +. +

foo _bar baz_

+```````````````````````````````` + + +```````````````````````````````` example +*foo __bar *baz bim__ bam* +. +

foo bar *baz bim bam

+```````````````````````````````` + + +Rule 16: + +```````````````````````````````` example +**foo **bar baz** +. +

**foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +*foo *bar baz* +. +

*foo bar baz

+```````````````````````````````` + + +Rule 17: + +```````````````````````````````` example +*[bar*](/url) +. +

*bar*

+```````````````````````````````` + + +```````````````````````````````` example +_foo [bar_](/url) +. +

_foo bar_

+```````````````````````````````` + + +```````````````````````````````` example +* +. +

*

+```````````````````````````````` + + +```````````````````````````````` example +** +. +

**

+```````````````````````````````` + + +```````````````````````````````` example +__ +. +

__

+```````````````````````````````` + + +```````````````````````````````` example +*a `*`* +. +

a *

+```````````````````````````````` + + +```````````````````````````````` example +_a `_`_ +. +

a _

+```````````````````````````````` + + +```````````````````````````````` example +**a +. +

**ahttp://foo.bar/?q=**

+```````````````````````````````` + + +```````````````````````````````` example +__a +. +

__ahttp://foo.bar/?q=__

+```````````````````````````````` + + + +## Links + +A link contains [link text] (the visible text), a [link destination] +(the URI that is the link destination), and optionally a [link title]. +There are two basic kinds of links in Markdown. In [inline links] the +destination and title are given immediately after the link text. In +[reference links] the destination and title are defined elsewhere in +the document. + +A [link text](@) consists of a sequence of zero or more +inline elements enclosed by square brackets (`[` and `]`). The +following rules apply: + +- Links may not contain other links, at any level of nesting. If + multiple otherwise valid link definitions appear nested inside each + other, the inner-most definition is used. + +- Brackets are allowed in the [link text] only if (a) they + are backslash-escaped or (b) they appear as a matched pair of brackets, + with an open bracket `[`, a sequence of zero or more inlines, and + a close bracket `]`. + +- Backtick [code spans], [autolinks], and raw [HTML tags] bind more tightly + than the brackets in link text. Thus, for example, + `` [foo`]` `` could not be a link text, since the second `]` + is part of a code span. + +- The brackets in link text bind more tightly than markers for + [emphasis and strong emphasis]. Thus, for example, `*[foo*](url)` is a link. + +A [link destination](@) consists of either + +- a sequence of zero or more characters between an opening `<` and a + closing `>` that contains no line breaks or unescaped + `<` or `>` characters, or + +- a nonempty sequence of characters that does not start with + `<`, does not include ASCII space or control characters, and + includes parentheses only if (a) they are backslash-escaped or + (b) they are part of a balanced pair of unescaped parentheses. + (Implementations may impose limits on parentheses nesting to + avoid performance issues, but at least three levels of nesting + should be supported.) + +A [link title](@) consists of either + +- a sequence of zero or more characters between straight double-quote + characters (`"`), including a `"` character only if it is + backslash-escaped, or + +- a sequence of zero or more characters between straight single-quote + characters (`'`), including a `'` character only if it is + backslash-escaped, or + +- a sequence of zero or more characters between matching parentheses + (`(...)`), including a `(` or `)` character only if it is + backslash-escaped. + +Although [link titles] may span multiple lines, they may not contain +a [blank line]. + +An [inline link](@) consists of a [link text] followed immediately +by a left parenthesis `(`, optional [whitespace], an optional +[link destination], an optional [link title] separated from the link +destination by [whitespace], optional [whitespace], and a right +parenthesis `)`. The link's text consists of the inlines contained +in the [link text] (excluding the enclosing square brackets). +The link's URI consists of the link destination, excluding enclosing +`<...>` if present, with backslash-escapes in effect as described +above. The link's title consists of the link title, excluding its +enclosing delimiters, with backslash-escapes in effect as described +above. + +Here is a simple inline link: + +```````````````````````````````` example +[link](/uri "title") +. +

link

+```````````````````````````````` + + +The title may be omitted: + +```````````````````````````````` example +[link](/uri) +. +

link

+```````````````````````````````` + + +Both the title and the destination may be omitted: + +```````````````````````````````` example +[link]() +. +

link

+```````````````````````````````` + + +```````````````````````````````` example +[link](<>) +. +

link

+```````````````````````````````` + +The destination can only contain spaces if it is +enclosed in pointy brackets: + +```````````````````````````````` example +[link](/my uri) +. +

[link](/my uri)

+```````````````````````````````` + +```````````````````````````````` example +[link](
) +. +

link

+```````````````````````````````` + +The destination cannot contain line breaks, +even if enclosed in pointy brackets: + +```````````````````````````````` example +[link](foo +bar) +. +

[link](foo +bar)

+```````````````````````````````` + +```````````````````````````````` example +[link]() +. +

[link]()

+```````````````````````````````` + +The destination can contain `)` if it is enclosed +in pointy brackets: + +```````````````````````````````` example +[a]() +. +

a

+```````````````````````````````` + +Pointy brackets that enclose links must be unescaped: + +```````````````````````````````` example +[link]() +. +

[link](<foo>)

+```````````````````````````````` + +These are not links, because the opening pointy bracket +is not matched properly: + +```````````````````````````````` example +[a]( +[a](c) +. +

[a](<b)c +[a](<b)c> +[a](c)

+```````````````````````````````` + +Parentheses inside the link destination may be escaped: + +```````````````````````````````` example +[link](\(foo\)) +. +

link

+```````````````````````````````` + +Any number of parentheses are allowed without escaping, as long as they are +balanced: + +```````````````````````````````` example +[link](foo(and(bar))) +. +

link

+```````````````````````````````` + +However, if you have unbalanced parentheses, you need to escape or use the +`<...>` form: + +```````````````````````````````` example +[link](foo\(and\(bar\)) +. +

link

+```````````````````````````````` + + +```````````````````````````````` example +[link]() +. +

link

+```````````````````````````````` + + +Parentheses and other symbols can also be escaped, as usual +in Markdown: + +```````````````````````````````` example +[link](foo\)\:) +. +

link

+```````````````````````````````` + + +A link can contain fragment identifiers and queries: + +```````````````````````````````` example +[link](#fragment) + +[link](http://example.com#fragment) + +[link](http://example.com?foo=3#frag) +. +

link

+

link

+

link

+```````````````````````````````` + + +Note that a backslash before a non-escapable character is +just a backslash: + +```````````````````````````````` example +[link](foo\bar) +. +

link

+```````````````````````````````` + + +URL-escaping should be left alone inside the destination, as all +URL-escaped characters are also valid URL characters. Entity and +numerical character references in the destination will be parsed +into the corresponding Unicode code points, as usual. These may +be optionally URL-escaped when written as HTML, but this spec +does not enforce any particular policy for rendering URLs in +HTML or other formats. Renderers may make different decisions +about how to escape or normalize URLs in the output. + +```````````````````````````````` example +[link](foo%20bä) +. +

link

+```````````````````````````````` + + +Note that, because titles can often be parsed as destinations, +if you try to omit the destination and keep the title, you'll +get unexpected results: + +```````````````````````````````` example +[link]("title") +. +

link

+```````````````````````````````` + + +Titles may be in single quotes, double quotes, or parentheses: + +```````````````````````````````` example +[link](/url "title") +[link](/url 'title') +[link](/url (title)) +. +

link +link +link

+```````````````````````````````` + + +Backslash escapes and entity and numeric character references +may be used in titles: + +```````````````````````````````` example +[link](/url "title \""") +. +

link

+```````````````````````````````` + + +Titles must be separated from the link using a [whitespace]. +Other [Unicode whitespace] like non-breaking space doesn't work. + +```````````````````````````````` example +[link](/url "title") +. +

link

+```````````````````````````````` + + +Nested balanced quotes are not allowed without escaping: + +```````````````````````````````` example +[link](/url "title "and" title") +. +

[link](/url "title "and" title")

+```````````````````````````````` + + +But it is easy to work around this by using a different quote type: + +```````````````````````````````` example +[link](/url 'title "and" title') +. +

link

+```````````````````````````````` + + +(Note: `Markdown.pl` did allow double quotes inside a double-quoted +title, and its test suite included a test demonstrating this. +But it is hard to see a good rationale for the extra complexity this +brings, since there are already many ways---backslash escaping, +entity and numeric character references, or using a different +quote type for the enclosing title---to write titles containing +double quotes. `Markdown.pl`'s handling of titles has a number +of other strange features. For example, it allows single-quoted +titles in inline links, but not reference links. And, in +reference links but not inline links, it allows a title to begin +with `"` and end with `)`. `Markdown.pl` 1.0.1 even allows +titles with no closing quotation mark, though 1.0.2b8 does not. +It seems preferable to adopt a simple, rational rule that works +the same way in inline links and link reference definitions.) + +[Whitespace] is allowed around the destination and title: + +```````````````````````````````` example +[link]( /uri + "title" ) +. +

link

+```````````````````````````````` + + +But it is not allowed between the link text and the +following parenthesis: + +```````````````````````````````` example +[link] (/uri) +. +

[link] (/uri)

+```````````````````````````````` + + +The link text may contain balanced brackets, but not unbalanced ones, +unless they are escaped: + +```````````````````````````````` example +[link [foo [bar]]](/uri) +. +

link [foo [bar]]

+```````````````````````````````` + + +```````````````````````````````` example +[link] bar](/uri) +. +

[link] bar](/uri)

+```````````````````````````````` + + +```````````````````````````````` example +[link [bar](/uri) +. +

[link bar

+```````````````````````````````` + + +```````````````````````````````` example +[link \[bar](/uri) +. +

link [bar

+```````````````````````````````` + + +The link text may contain inline content: + +```````````````````````````````` example +[link *foo **bar** `#`*](/uri) +. +

link foo bar #

+```````````````````````````````` + + +```````````````````````````````` example +[![moon](moon.jpg)](/uri) +. +

moon

+```````````````````````````````` + + +However, links may not contain other links, at any level of nesting. + +```````````````````````````````` example +[foo [bar](/uri)](/uri) +. +

[foo bar](/uri)

+```````````````````````````````` + + +```````````````````````````````` example +[foo *[bar [baz](/uri)](/uri)*](/uri) +. +

[foo [bar baz](/uri)](/uri)

+```````````````````````````````` + + +```````````````````````````````` example +![[[foo](uri1)](uri2)](uri3) +. +

[foo](uri2)

+```````````````````````````````` + + +These cases illustrate the precedence of link text grouping over +emphasis grouping: + +```````````````````````````````` example +*[foo*](/uri) +. +

*foo*

+```````````````````````````````` + + +```````````````````````````````` example +[foo *bar](baz*) +. +

foo *bar

+```````````````````````````````` + + +Note that brackets that *aren't* part of links do not take +precedence: + +```````````````````````````````` example +*foo [bar* baz] +. +

foo [bar baz]

+```````````````````````````````` + + +These cases illustrate the precedence of HTML tags, code spans, +and autolinks over link grouping: + +```````````````````````````````` example +[foo +. +

[foo

+```````````````````````````````` + + +```````````````````````````````` example +[foo`](/uri)` +. +

[foo](/uri)

+```````````````````````````````` + + +```````````````````````````````` example +[foo +. +

[foohttp://example.com/?search=](uri)

+```````````````````````````````` + + +There are three kinds of [reference link](@)s: +[full](#full-reference-link), [collapsed](#collapsed-reference-link), +and [shortcut](#shortcut-reference-link). + +A [full reference link](@) +consists of a [link text] immediately followed by a [link label] +that [matches] a [link reference definition] elsewhere in the document. + +A [link label](@) begins with a left bracket (`[`) and ends +with the first right bracket (`]`) that is not backslash-escaped. +Between these brackets there must be at least one [non-whitespace character]. +Unescaped square bracket characters are not allowed inside the +opening and closing square brackets of [link labels]. A link +label can have at most 999 characters inside the square +brackets. + +One label [matches](@) +another just in case their normalized forms are equal. To normalize a +label, strip off the opening and closing brackets, +perform the *Unicode case fold*, strip leading and trailing +[whitespace] and collapse consecutive internal +[whitespace] to a single space. If there are multiple +matching reference link definitions, the one that comes first in the +document is used. (It is desirable in such cases to emit a warning.) + +The contents of the first link label are parsed as inlines, which are +used as the link's text. The link's URI and title are provided by the +matching [link reference definition]. + +Here is a simple example: + +```````````````````````````````` example +[foo][bar] + +[bar]: /url "title" +. +

foo

+```````````````````````````````` + + +The rules for the [link text] are the same as with +[inline links]. Thus: + +The link text may contain balanced brackets, but not unbalanced ones, +unless they are escaped: + +```````````````````````````````` example +[link [foo [bar]]][ref] + +[ref]: /uri +. +

link [foo [bar]]

+```````````````````````````````` + + +```````````````````````````````` example +[link \[bar][ref] + +[ref]: /uri +. +

link [bar

+```````````````````````````````` + + +The link text may contain inline content: + +```````````````````````````````` example +[link *foo **bar** `#`*][ref] + +[ref]: /uri +. +

link foo bar #

+```````````````````````````````` + + +```````````````````````````````` example +[![moon](moon.jpg)][ref] + +[ref]: /uri +. +

moon

+```````````````````````````````` + + +However, links may not contain other links, at any level of nesting. + +```````````````````````````````` example +[foo [bar](/uri)][ref] + +[ref]: /uri +. +

[foo bar]ref

+```````````````````````````````` + + +```````````````````````````````` example +[foo *bar [baz][ref]*][ref] + +[ref]: /uri +. +

[foo bar baz]ref

+```````````````````````````````` + + +(In the examples above, we have two [shortcut reference links] +instead of one [full reference link].) + +The following cases illustrate the precedence of link text grouping over +emphasis grouping: + +```````````````````````````````` example +*[foo*][ref] + +[ref]: /uri +. +

*foo*

+```````````````````````````````` + + +```````````````````````````````` example +[foo *bar][ref] + +[ref]: /uri +. +

foo *bar

+```````````````````````````````` + + +These cases illustrate the precedence of HTML tags, code spans, +and autolinks over link grouping: + +```````````````````````````````` example +[foo + +[ref]: /uri +. +

[foo

+```````````````````````````````` + + +```````````````````````````````` example +[foo`][ref]` + +[ref]: /uri +. +

[foo][ref]

+```````````````````````````````` + + +```````````````````````````````` example +[foo + +[ref]: /uri +. +

[foohttp://example.com/?search=][ref]

+```````````````````````````````` + + +Matching is case-insensitive: + +```````````````````````````````` example +[foo][BaR] + +[bar]: /url "title" +. +

foo

+```````````````````````````````` + + +Unicode case fold is used: + +```````````````````````````````` example +[Толпой][Толпой] is a Russian word. + +[ТОЛПОЙ]: /url +. +

Толпой is a Russian word.

+```````````````````````````````` + + +Consecutive internal [whitespace] is treated as one space for +purposes of determining matching: + +```````````````````````````````` example +[Foo + bar]: /url + +[Baz][Foo bar] +. +

Baz

+```````````````````````````````` + + +No [whitespace] is allowed between the [link text] and the +[link label]: + +```````````````````````````````` example +[foo] [bar] + +[bar]: /url "title" +. +

[foo] bar

+```````````````````````````````` + + +```````````````````````````````` example +[foo] +[bar] + +[bar]: /url "title" +. +

[foo] +bar

+```````````````````````````````` + + +This is a departure from John Gruber's original Markdown syntax +description, which explicitly allows whitespace between the link +text and the link label. It brings reference links in line with +[inline links], which (according to both original Markdown and +this spec) cannot have whitespace after the link text. More +importantly, it prevents inadvertent capture of consecutive +[shortcut reference links]. If whitespace is allowed between the +link text and the link label, then in the following we will have +a single reference link, not two shortcut reference links, as +intended: + +``` markdown +[foo] +[bar] + +[foo]: /url1 +[bar]: /url2 +``` + +(Note that [shortcut reference links] were introduced by Gruber +himself in a beta version of `Markdown.pl`, but never included +in the official syntax description. Without shortcut reference +links, it is harmless to allow space between the link text and +link label; but once shortcut references are introduced, it is +too dangerous to allow this, as it frequently leads to +unintended results.) + +When there are multiple matching [link reference definitions], +the first is used: + +```````````````````````````````` example +[foo]: /url1 + +[foo]: /url2 + +[bar][foo] +. +

bar

+```````````````````````````````` + + +Note that matching is performed on normalized strings, not parsed +inline content. So the following does not match, even though the +labels define equivalent inline content: + +```````````````````````````````` example +[bar][foo\!] + +[foo!]: /url +. +

[bar][foo!]

+```````````````````````````````` + + +[Link labels] cannot contain brackets, unless they are +backslash-escaped: + +```````````````````````````````` example +[foo][ref[] + +[ref[]: /uri +. +

[foo][ref[]

+

[ref[]: /uri

+```````````````````````````````` + + +```````````````````````````````` example +[foo][ref[bar]] + +[ref[bar]]: /uri +. +

[foo][ref[bar]]

+

[ref[bar]]: /uri

+```````````````````````````````` + + +```````````````````````````````` example +[[[foo]]] + +[[[foo]]]: /url +. +

[[[foo]]]

+

[[[foo]]]: /url

+```````````````````````````````` + + +```````````````````````````````` example +[foo][ref\[] + +[ref\[]: /uri +. +

foo

+```````````````````````````````` + + +Note that in this example `]` is not backslash-escaped: + +```````````````````````````````` example +[bar\\]: /uri + +[bar\\] +. +

bar\

+```````````````````````````````` + + +A [link label] must contain at least one [non-whitespace character]: + +```````````````````````````````` example +[] + +[]: /uri +. +

[]

+

[]: /uri

+```````````````````````````````` + + +```````````````````````````````` example +[ + ] + +[ + ]: /uri +. +

[ +]

+

[ +]: /uri

+```````````````````````````````` + + +A [collapsed reference link](@) +consists of a [link label] that [matches] a +[link reference definition] elsewhere in the +document, followed by the string `[]`. +The contents of the first link label are parsed as inlines, +which are used as the link's text. The link's URI and title are +provided by the matching reference link definition. Thus, +`[foo][]` is equivalent to `[foo][foo]`. + +```````````````````````````````` example +[foo][] + +[foo]: /url "title" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[*foo* bar][] + +[*foo* bar]: /url "title" +. +

foo bar

+```````````````````````````````` + + +The link labels are case-insensitive: + +```````````````````````````````` example +[Foo][] + +[foo]: /url "title" +. +

Foo

+```````````````````````````````` + + + +As with full reference links, [whitespace] is not +allowed between the two sets of brackets: + +```````````````````````````````` example +[foo] +[] + +[foo]: /url "title" +. +

foo +[]

+```````````````````````````````` + + +A [shortcut reference link](@) +consists of a [link label] that [matches] a +[link reference definition] elsewhere in the +document and is not followed by `[]` or a link label. +The contents of the first link label are parsed as inlines, +which are used as the link's text. The link's URI and title +are provided by the matching link reference definition. +Thus, `[foo]` is equivalent to `[foo][]`. + +```````````````````````````````` example +[foo] + +[foo]: /url "title" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[*foo* bar] + +[*foo* bar]: /url "title" +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +[[*foo* bar]] + +[*foo* bar]: /url "title" +. +

[foo bar]

+```````````````````````````````` + + +```````````````````````````````` example +[[bar [foo] + +[foo]: /url +. +

[[bar foo

+```````````````````````````````` + + +The link labels are case-insensitive: + +```````````````````````````````` example +[Foo] + +[foo]: /url "title" +. +

Foo

+```````````````````````````````` + + +A space after the link text should be preserved: + +```````````````````````````````` example +[foo] bar + +[foo]: /url +. +

foo bar

+```````````````````````````````` + + +If you just want bracketed text, you can backslash-escape the +opening bracket to avoid links: + +```````````````````````````````` example +\[foo] + +[foo]: /url "title" +. +

[foo]

+```````````````````````````````` + + +Note that this is a link, because a link label ends with the first +following closing bracket: + +```````````````````````````````` example +[foo*]: /url + +*[foo*] +. +

*foo*

+```````````````````````````````` + + +Full and compact references take precedence over shortcut +references: + +```````````````````````````````` example +[foo][bar] + +[foo]: /url1 +[bar]: /url2 +. +

foo

+```````````````````````````````` + +```````````````````````````````` example +[foo][] + +[foo]: /url1 +. +

foo

+```````````````````````````````` + +Inline links also take precedence: + +```````````````````````````````` example +[foo]() + +[foo]: /url1 +. +

foo

+```````````````````````````````` + +```````````````````````````````` example +[foo](not a link) + +[foo]: /url1 +. +

foo(not a link)

+```````````````````````````````` + +In the following case `[bar][baz]` is parsed as a reference, +`[foo]` as normal text: + +```````````````````````````````` example +[foo][bar][baz] + +[baz]: /url +. +

[foo]bar

+```````````````````````````````` + + +Here, though, `[foo][bar]` is parsed as a reference, since +`[bar]` is defined: + +```````````````````````````````` example +[foo][bar][baz] + +[baz]: /url1 +[bar]: /url2 +. +

foobaz

+```````````````````````````````` + + +Here `[foo]` is not parsed as a shortcut reference, because it +is followed by a link label (even though `[bar]` is not defined): + +```````````````````````````````` example +[foo][bar][baz] + +[baz]: /url1 +[foo]: /url2 +. +

[foo]bar

+```````````````````````````````` + + + +## Images + +Syntax for images is like the syntax for links, with one +difference. Instead of [link text], we have an +[image description](@). The rules for this are the +same as for [link text], except that (a) an +image description starts with `![` rather than `[`, and +(b) an image description may contain links. +An image description has inline elements +as its contents. When an image is rendered to HTML, +this is standardly used as the image's `alt` attribute. + +```````````````````````````````` example +![foo](/url "title") +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![foo *bar*] + +[foo *bar*]: train.jpg "train & tracks" +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo ![bar](/url)](/url2) +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo [bar](/url)](/url2) +. +

foo bar

+```````````````````````````````` + + +Though this spec is concerned with parsing, not rendering, it is +recommended that in rendering to HTML, only the plain string content +of the [image description] be used. Note that in +the above example, the alt attribute's value is `foo bar`, not `foo +[bar](/url)` or `foo bar`. Only the plain string +content is rendered, without formatting. + +```````````````````````````````` example +![foo *bar*][] + +[foo *bar*]: train.jpg "train & tracks" +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo *bar*][foobar] + +[FOOBAR]: train.jpg "train & tracks" +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo](train.jpg) +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +My ![foo bar](/path/to/train.jpg "title" ) +. +

My foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo]() +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![](/url) +. +

+```````````````````````````````` + + +Reference-style: + +```````````````````````````````` example +![foo][bar] + +[bar]: /url +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![foo][bar] + +[BAR]: /url +. +

foo

+```````````````````````````````` + + +Collapsed: + +```````````````````````````````` example +![foo][] + +[foo]: /url "title" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![*foo* bar][] + +[*foo* bar]: /url "title" +. +

foo bar

+```````````````````````````````` + + +The labels are case-insensitive: + +```````````````````````````````` example +![Foo][] + +[foo]: /url "title" +. +

Foo

+```````````````````````````````` + + +As with reference links, [whitespace] is not allowed +between the two sets of brackets: + +```````````````````````````````` example +![foo] +[] + +[foo]: /url "title" +. +

foo +[]

+```````````````````````````````` + + +Shortcut: + +```````````````````````````````` example +![foo] + +[foo]: /url "title" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![*foo* bar] + +[*foo* bar]: /url "title" +. +

foo bar

+```````````````````````````````` + + +Note that link labels cannot contain unescaped brackets: + +```````````````````````````````` example +![[foo]] + +[[foo]]: /url "title" +. +

![[foo]]

+

[[foo]]: /url "title"

+```````````````````````````````` + + +The link labels are case-insensitive: + +```````````````````````````````` example +![Foo] + +[foo]: /url "title" +. +

Foo

+```````````````````````````````` + + +If you just want a literal `!` followed by bracketed text, you can +backslash-escape the opening `[`: + +```````````````````````````````` example +!\[foo] + +[foo]: /url "title" +. +

![foo]

+```````````````````````````````` + + +If you want a link after a literal `!`, backslash-escape the +`!`: + +```````````````````````````````` example +\![foo] + +[foo]: /url "title" +. +

!foo

+```````````````````````````````` + + +## Autolinks + +[Autolink](@)s are absolute URIs and email addresses inside +`<` and `>`. They are parsed as links, with the URL or email address +as the link label. + +A [URI autolink](@) consists of `<`, followed by an +[absolute URI] followed by `>`. It is parsed as +a link to the URI, with the URI as the link's label. + +An [absolute URI](@), +for these purposes, consists of a [scheme] followed by a colon (`:`) +followed by zero or more characters other than ASCII +[whitespace] and control characters, `<`, and `>`. If +the URI includes these characters, they must be percent-encoded +(e.g. `%20` for a space). + +For purposes of this spec, a [scheme](@) is any sequence +of 2--32 characters beginning with an ASCII letter and followed +by any combination of ASCII letters, digits, or the symbols plus +("+"), period ("."), or hyphen ("-"). + +Here are some valid autolinks: + +```````````````````````````````` example + +. +

http://foo.bar.baz

+```````````````````````````````` + + +```````````````````````````````` example + +. +

http://foo.bar.baz/test?q=hello&id=22&boolean

+```````````````````````````````` + + +```````````````````````````````` example + +. +

irc://foo.bar:2233/baz

+```````````````````````````````` + + +Uppercase is also fine: + +```````````````````````````````` example + +. +

MAILTO:FOO@BAR.BAZ

+```````````````````````````````` + + +Note that many strings that count as [absolute URIs] for +purposes of this spec are not valid URIs, because their +schemes are not registered or because of other problems +with their syntax: + +```````````````````````````````` example + +. +

a+b+c:d

+```````````````````````````````` + + +```````````````````````````````` example + +. +

made-up-scheme://foo,bar

+```````````````````````````````` + + +```````````````````````````````` example + +. +

http://../

+```````````````````````````````` + + +```````````````````````````````` example + +. +

localhost:5001/foo

+```````````````````````````````` + + +Spaces are not allowed in autolinks: + +```````````````````````````````` example + +. +

<http://foo.bar/baz bim>

+```````````````````````````````` + + +Backslash-escapes do not work inside autolinks: + +```````````````````````````````` example + +. +

http://example.com/\[\

+```````````````````````````````` + + +An [email autolink](@) +consists of `<`, followed by an [email address], +followed by `>`. The link's label is the email address, +and the URL is `mailto:` followed by the email address. + +An [email address](@), +for these purposes, is anything that matches +the [non-normative regex from the HTML5 +spec](https://html.spec.whatwg.org/multipage/forms.html#e-mail-state-(type=email)): + + /^[a-zA-Z0-9.!#$%&'*+/=?^_`{|}~-]+@[a-zA-Z0-9](?:[a-zA-Z0-9-]{0,61}[a-zA-Z0-9])? + (?:\.[a-zA-Z0-9](?:[a-zA-Z0-9-]{0,61}[a-zA-Z0-9])?)*$/ + +Examples of email autolinks: + +```````````````````````````````` example + +. +

foo@bar.example.com

+```````````````````````````````` + + +```````````````````````````````` example + +. +

foo+special@Bar.baz-bar0.com

+```````````````````````````````` + + +Backslash-escapes do not work inside email autolinks: + +```````````````````````````````` example + +. +

<foo+@bar.example.com>

+```````````````````````````````` + + +These are not autolinks: + +```````````````````````````````` example +<> +. +

<>

+```````````````````````````````` + + +```````````````````````````````` example +< http://foo.bar > +. +

< http://foo.bar >

+```````````````````````````````` + + +```````````````````````````````` example + +. +

<m:abc>

+```````````````````````````````` + + +```````````````````````````````` example + +. +

<foo.bar.baz>

+```````````````````````````````` + + +```````````````````````````````` example +http://example.com +. +

http://example.com

+```````````````````````````````` + + +```````````````````````````````` example +foo@bar.example.com +. +

foo@bar.example.com

+```````````````````````````````` + + +## Raw HTML + +Text between `<` and `>` that looks like an HTML tag is parsed as a +raw HTML tag and will be rendered in HTML without escaping. +Tag and attribute names are not limited to current HTML tags, +so custom tags (and even, say, DocBook tags) may be used. + +Here is the grammar for tags: + +A [tag name](@) consists of an ASCII letter +followed by zero or more ASCII letters, digits, or +hyphens (`-`). + +An [attribute](@) consists of [whitespace], +an [attribute name], and an optional +[attribute value specification]. + +An [attribute name](@) +consists of an ASCII letter, `_`, or `:`, followed by zero or more ASCII +letters, digits, `_`, `.`, `:`, or `-`. (Note: This is the XML +specification restricted to ASCII. HTML5 is laxer.) + +An [attribute value specification](@) +consists of optional [whitespace], +a `=` character, optional [whitespace], and an [attribute +value]. + +An [attribute value](@) +consists of an [unquoted attribute value], +a [single-quoted attribute value], or a [double-quoted attribute value]. + +An [unquoted attribute value](@) +is a nonempty string of characters not +including [whitespace], `"`, `'`, `=`, `<`, `>`, or `` ` ``. + +A [single-quoted attribute value](@) +consists of `'`, zero or more +characters not including `'`, and a final `'`. + +A [double-quoted attribute value](@) +consists of `"`, zero or more +characters not including `"`, and a final `"`. + +An [open tag](@) consists of a `<` character, a [tag name], +zero or more [attributes], optional [whitespace], an optional `/` +character, and a `>` character. + +A [closing tag](@) consists of the string ``. + +An [HTML comment](@) consists of ``, +where *text* does not start with `>` or `->`, does not end with `-`, +and does not contain `--`. (See the +[HTML5 spec](http://www.w3.org/TR/html5/syntax.html#comments).) + +A [processing instruction](@) +consists of the string ``, and the string +`?>`. + +A [declaration](@) consists of the +string ``, and the character `>`. + +A [CDATA section](@) consists of +the string ``, and the string `]]>`. + +An [HTML tag](@) consists of an [open tag], a [closing tag], +an [HTML comment], a [processing instruction], a [declaration], +or a [CDATA section]. + +Here are some simple open tags: + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +Empty elements: + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +[Whitespace] is allowed: + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +With attributes: + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +Custom tag names can be used: + +```````````````````````````````` example +Foo +. +

Foo

+```````````````````````````````` + + +Illegal tag names, not parsed as HTML: + +```````````````````````````````` example +<33> <__> +. +

<33> <__>

+```````````````````````````````` + + +Illegal attribute names: + +```````````````````````````````` example +
+. +

<a h*#ref="hi">

+```````````````````````````````` + + +Illegal attribute values: + +```````````````````````````````` example +
+. +

</a href="foo">

+```````````````````````````````` + + +Comments: + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +foo +. +

foo <!-- not a comment -- two hyphens -->

+```````````````````````````````` + + +Not comments: + +```````````````````````````````` example +foo foo --> + +foo +. +

foo <!--> foo -->

+

foo <!-- foo--->

+```````````````````````````````` + + +Processing instructions: + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +Declarations: + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +CDATA sections: + +```````````````````````````````` example +foo &<]]> +. +

foo &<]]>

+```````````````````````````````` + + +Entity and numeric character references are preserved in HTML +attributes: + +```````````````````````````````` example +foo
+. +

foo

+```````````````````````````````` + + +Backslash escapes do not work in HTML attributes: + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example + +. +

<a href=""">

+```````````````````````````````` + + +## Hard line breaks + +A line break (not in a code span or HTML tag) that is preceded +by two or more spaces and does not occur at the end of a block +is parsed as a [hard line break](@) (rendered +in HTML as a `
` tag): + +```````````````````````````````` example +foo +baz +. +

foo
+baz

+```````````````````````````````` + + +For a more visible alternative, a backslash before the +[line ending] may be used instead of two spaces: + +```````````````````````````````` example +foo\ +baz +. +

foo
+baz

+```````````````````````````````` + + +More than two spaces can be used: + +```````````````````````````````` example +foo +baz +. +

foo
+baz

+```````````````````````````````` + + +Leading spaces at the beginning of the next line are ignored: + +```````````````````````````````` example +foo + bar +. +

foo
+bar

+```````````````````````````````` + + +```````````````````````````````` example +foo\ + bar +. +

foo
+bar

+```````````````````````````````` + + +Line breaks can occur inside emphasis, links, and other constructs +that allow inline content: + +```````````````````````````````` example +*foo +bar* +. +

foo
+bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo\ +bar* +. +

foo
+bar

+```````````````````````````````` + + +Line breaks do not occur inside code spans + +```````````````````````````````` example +`code +span` +. +

code span

+```````````````````````````````` + + +```````````````````````````````` example +`code\ +span` +. +

code\ span

+```````````````````````````````` + + +or HTML tags: + +```````````````````````````````` example +
+. +

+```````````````````````````````` + + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +Hard line breaks are for separating inline content within a block. +Neither syntax for hard line breaks works at the end of a paragraph or +other block element: + +```````````````````````````````` example +foo\ +. +

foo\

+```````````````````````````````` + + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +### foo\ +. +

foo\

+```````````````````````````````` + + +```````````````````````````````` example +### foo +. +

foo

+```````````````````````````````` + + +## Soft line breaks + +A regular line break (not in a code span or HTML tag) that is not +preceded by two or more spaces or a backslash is parsed as a +[softbreak](@). (A softbreak may be rendered in HTML either as a +[line ending] or as a space. The result will be the same in +browsers. In the examples here, a [line ending] will be used.) + +```````````````````````````````` example +foo +baz +. +

foo +baz

+```````````````````````````````` + + +Spaces at the end of the line and beginning of the next line are +removed: + +```````````````````````````````` example +foo + baz +. +

foo +baz

+```````````````````````````````` + + +A conforming parser may render a soft line break in HTML either as a +line break or as a space. + +A renderer may also provide an option to render soft line breaks +as hard line breaks. + +## Textual content + +Any characters not given an interpretation by the above rules will +be parsed as plain textual content. + +```````````````````````````````` example +hello $.;'there +. +

hello $.;'there

+```````````````````````````````` + + +```````````````````````````````` example +Foo χρῆν +. +

Foo χρῆν

+```````````````````````````````` + + +Internal spaces are preserved verbatim: + +```````````````````````````````` example +Multiple spaces +. +

Multiple spaces

+```````````````````````````````` + + + + +# Appendix: A parsing strategy + +In this appendix we describe some features of the parsing strategy +used in the CommonMark reference implementations. + +## Overview + +Parsing has two phases: + +1. In the first phase, lines of input are consumed and the block +structure of the document---its division into paragraphs, block quotes, +list items, and so on---is constructed. Text is assigned to these +blocks but not parsed. Link reference definitions are parsed and a +map of links is constructed. + +2. In the second phase, the raw text contents of paragraphs and headings +are parsed into sequences of Markdown inline elements (strings, +code spans, links, emphasis, and so on), using the map of link +references constructed in phase 1. + +At each point in processing, the document is represented as a tree of +**blocks**. The root of the tree is a `document` block. The `document` +may have any number of other blocks as **children**. These children +may, in turn, have other blocks as children. The last child of a block +is normally considered **open**, meaning that subsequent lines of input +can alter its contents. (Blocks that are not open are **closed**.) +Here, for example, is a possible document tree, with the open blocks +marked by arrows: + +``` tree +-> document + -> block_quote + paragraph + "Lorem ipsum dolor\nsit amet." + -> list (type=bullet tight=true bullet_char=-) + list_item + paragraph + "Qui *quodsi iracundia*" + -> list_item + -> paragraph + "aliquando id" +``` + +## Phase 1: block structure + +Each line that is processed has an effect on this tree. The line is +analyzed and, depending on its contents, the document may be altered +in one or more of the following ways: + +1. One or more open blocks may be closed. +2. One or more new blocks may be created as children of the + last open block. +3. Text may be added to the last (deepest) open block remaining + on the tree. + +Once a line has been incorporated into the tree in this way, +it can be discarded, so input can be read in a stream. + +For each line, we follow this procedure: + +1. First we iterate through the open blocks, starting with the +root document, and descending through last children down to the last +open block. Each block imposes a condition that the line must satisfy +if the block is to remain open. For example, a block quote requires a +`>` character. A paragraph requires a non-blank line. +In this phase we may match all or just some of the open +blocks. But we cannot close unmatched blocks yet, because we may have a +[lazy continuation line]. + +2. Next, after consuming the continuation markers for existing +blocks, we look for new block starts (e.g. `>` for a block quote). +If we encounter a new block start, we close any blocks unmatched +in step 1 before creating the new block as a child of the last +matched block. + +3. Finally, we look at the remainder of the line (after block +markers like `>`, list markers, and indentation have been consumed). +This is text that can be incorporated into the last open +block (a paragraph, code block, heading, or raw HTML). + +Setext headings are formed when we see a line of a paragraph +that is a [setext heading underline]. + +Reference link definitions are detected when a paragraph is closed; +the accumulated text lines are parsed to see if they begin with +one or more reference link definitions. Any remainder becomes a +normal paragraph. + +We can see how this works by considering how the tree above is +generated by four lines of Markdown: + +``` markdown +> Lorem ipsum dolor +sit amet. +> - Qui *quodsi iracundia* +> - aliquando id +``` + +At the outset, our document model is just + +``` tree +-> document +``` + +The first line of our text, + +``` markdown +> Lorem ipsum dolor +``` + +causes a `block_quote` block to be created as a child of our +open `document` block, and a `paragraph` block as a child of +the `block_quote`. Then the text is added to the last open +block, the `paragraph`: + +``` tree +-> document + -> block_quote + -> paragraph + "Lorem ipsum dolor" +``` + +The next line, + +``` markdown +sit amet. +``` + +is a "lazy continuation" of the open `paragraph`, so it gets added +to the paragraph's text: + +``` tree +-> document + -> block_quote + -> paragraph + "Lorem ipsum dolor\nsit amet." +``` + +The third line, + +``` markdown +> - Qui *quodsi iracundia* +``` + +causes the `paragraph` block to be closed, and a new `list` block +opened as a child of the `block_quote`. A `list_item` is also +added as a child of the `list`, and a `paragraph` as a child of +the `list_item`. The text is then added to the new `paragraph`: + +``` tree +-> document + -> block_quote + paragraph + "Lorem ipsum dolor\nsit amet." + -> list (type=bullet tight=true bullet_char=-) + -> list_item + -> paragraph + "Qui *quodsi iracundia*" +``` + +The fourth line, + +``` markdown +> - aliquando id +``` + +causes the `list_item` (and its child the `paragraph`) to be closed, +and a new `list_item` opened up as child of the `list`. A `paragraph` +is added as a child of the new `list_item`, to contain the text. +We thus obtain the final tree: + +``` tree +-> document + -> block_quote + paragraph + "Lorem ipsum dolor\nsit amet." + -> list (type=bullet tight=true bullet_char=-) + list_item + paragraph + "Qui *quodsi iracundia*" + -> list_item + -> paragraph + "aliquando id" +``` + +## Phase 2: inline structure + +Once all of the input has been parsed, all open blocks are closed. + +We then "walk the tree," visiting every node, and parse raw +string contents of paragraphs and headings as inlines. At this +point we have seen all the link reference definitions, so we can +resolve reference links as we go. + +``` tree +document + block_quote + paragraph + str "Lorem ipsum dolor" + softbreak + str "sit amet." + list (type=bullet tight=true bullet_char=-) + list_item + paragraph + str "Qui " + emph + str "quodsi iracundia" + list_item + paragraph + str "aliquando id" +``` + +Notice how the [line ending] in the first paragraph has +been parsed as a `softbreak`, and the asterisks in the first list item +have become an `emph`. + +### An algorithm for parsing nested emphasis and links + +By far the trickiest part of inline parsing is handling emphasis, +strong emphasis, links, and images. This is done using the following +algorithm. + +When we're parsing inlines and we hit either + +- a run of `*` or `_` characters, or +- a `[` or `![` + +we insert a text node with these symbols as its literal content, and we +add a pointer to this text node to the [delimiter stack](@). + +The [delimiter stack] is a doubly linked list. Each +element contains a pointer to a text node, plus information about + +- the type of delimiter (`[`, `![`, `*`, `_`) +- the number of delimiters, +- whether the delimiter is "active" (all are active to start), and +- whether the delimiter is a potential opener, a potential closer, + or both (which depends on what sort of characters precede + and follow the delimiters). + +When we hit a `]` character, we call the *look for link or image* +procedure (see below). + +When we hit the end of the input, we call the *process emphasis* +procedure (see below), with `stack_bottom` = NULL. + +#### *look for link or image* + +Starting at the top of the delimiter stack, we look backwards +through the stack for an opening `[` or `![` delimiter. + +- If we don't find one, we return a literal text node `]`. + +- If we do find one, but it's not *active*, we remove the inactive + delimiter from the stack, and return a literal text node `]`. + +- If we find one and it's active, then we parse ahead to see if + we have an inline link/image, reference link/image, compact reference + link/image, or shortcut reference link/image. + + + If we don't, then we remove the opening delimiter from the + delimiter stack and return a literal text node `]`. + + + If we do, then + + * We return a link or image node whose children are the inlines + after the text node pointed to by the opening delimiter. + + * We run *process emphasis* on these inlines, with the `[` opener + as `stack_bottom`. + + * We remove the opening delimiter. + + * If we have a link (and not an image), we also set all + `[` delimiters before the opening delimiter to *inactive*. (This + will prevent us from getting links within links.) + +#### *process emphasis* + +Parameter `stack_bottom` sets a lower bound to how far we +descend in the [delimiter stack]. If it is NULL, we can +go all the way to the bottom. Otherwise, we stop before +visiting `stack_bottom`. + +Let `current_position` point to the element on the [delimiter stack] +just above `stack_bottom` (or the first element if `stack_bottom` +is NULL). + +We keep track of the `openers_bottom` for each delimiter +type (`*`, `_`) and each length of the closing delimiter run +(modulo 3). Initialize this to `stack_bottom`. + +Then we repeat the following until we run out of potential +closers: + +- Move `current_position` forward in the delimiter stack (if needed) + until we find the first potential closer with delimiter `*` or `_`. + (This will be the potential closer closest + to the beginning of the input -- the first one in parse order.) + +- Now, look back in the stack (staying above `stack_bottom` and + the `openers_bottom` for this delimiter type) for the + first matching potential opener ("matching" means same delimiter). + +- If one is found: + + + Figure out whether we have emphasis or strong emphasis: + if both closer and opener spans have length >= 2, we have + strong, otherwise regular. + + + Insert an emph or strong emph node accordingly, after + the text node corresponding to the opener. + + + Remove any delimiters between the opener and closer from + the delimiter stack. + + + Remove 1 (for regular emph) or 2 (for strong emph) delimiters + from the opening and closing text nodes. If they become empty + as a result, remove them and remove the corresponding element + of the delimiter stack. If the closing node is removed, reset + `current_position` to the next element in the stack. + +- If none is found: + + + Set `openers_bottom` to the element before `current_position`. + (We know that there are no openers for this kind of closer up to and + including this point, so this puts a lower bound on future searches.) + + + If the closer at `current_position` is not a potential opener, + remove it from the delimiter stack (since we know it can't + be a closer either). + + + Advance `current_position` to the next element in the stack. + +After we're done, we remove all delimiters above `stack_bottom` from the +delimiter stack. + diff --git a/_benchmark/cmark/cmark_benchmark.c b/_benchmark/cmark/cmark_benchmark.c new file mode 100644 index 0000000..b474358 --- /dev/null +++ b/_benchmark/cmark/cmark_benchmark.c @@ -0,0 +1,91 @@ +#include +#include +#ifdef WIN32 +# include +#else +# include +# include +#endif +#include "cmark.h" + + +#ifdef WIN32 + +double get_time() +{ + LARGE_INTEGER t, f; + QueryPerformanceCounter(&t); + QueryPerformanceFrequency(&f); + return (double)t.QuadPart/(double)f.QuadPart; +} + +#else + + +double get_time() +{ + struct timeval t; + struct timezone tzp; + gettimeofday(&t, &tzp); + return t.tv_sec + t.tv_usec*1e-6; +} + +#endif + +int main(int argc, char **argv) { + char *markdown_file; + FILE *fp; + size_t size; + char *buf; + char *html; + double start, sum; + int i, n; + + n = argc > 1 ? atoi(argv[1]) : 50; + markdown_file = argc > 2 ? argv[2] : "_data.md"; + + fp = fopen(markdown_file,"r"); + if(fp == NULL){ + fprintf(stderr, "can not open %s", markdown_file); + exit(1); + } + + if(fseek(fp, 0, SEEK_END) != 0) { + fprintf(stderr, "can not seek %s", markdown_file); + exit(1); + } + if((size = ftell(fp)) < 0) { + fprintf(stderr, "can not get size of %s", markdown_file); + exit(1); + } + if(fseek(fp, 0, SEEK_SET) != 0) { + fprintf(stderr, "can not seek %s", markdown_file); + exit(1); + } + buf = malloc(sizeof(char) * size); + if(buf == NULL) { + fprintf(stderr, "can not allocate memory for %s", markdown_file); + exit(1); + } + + if(fread(buf, 1, size, fp) < size) { + fprintf(stderr, "failed to read for %s", markdown_file); + exit(1); + } + + fclose(fp); + + for(i = 0; i < n; i++) { + start = get_time(); + html = cmark_markdown_to_html(buf, size, CMARK_OPT_UNSAFE); + free(html); + sum += get_time() - start; + } + printf("----------- cmark -----------\n"); + printf("file: %s\n", markdown_file); + printf("iteration: %d\n", n); + printf("average: %.10f sec\n", sum / (double)n); + + free(buf); + return 0; +} diff --git a/_benchmark/cmark/goldmark_benchmark.go b/_benchmark/cmark/goldmark_benchmark.go new file mode 100644 index 0000000..219305e --- /dev/null +++ b/_benchmark/cmark/goldmark_benchmark.go @@ -0,0 +1,59 @@ +package main + +import ( + "bytes" + "fmt" + "io/ioutil" + "log" + "os" + "runtime/pprof" + "strconv" + "time" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" +) + +func main() { + n := 50 + file := "_data.md" + if len(os.Args) > 1 { + n, _ = strconv.Atoi(os.Args[1]) + } + if len(os.Args) > 2 { + file = os.Args[2] + } + if len(os.Args) > 3 { + f, err := os.Create(os.Args[3]) + if err != nil { + log.Fatal(err) + } + defer f.Close() + + if err := pprof.StartCPUProfile(f); err != nil { + log.Fatal(err) + } + defer pprof.StopCPUProfile() + } + source, err := ioutil.ReadFile(file) + if err != nil { + panic(err) + } + markdown := goldmark.New(goldmark.WithRendererOptions(html.WithXHTML(), html.WithUnsafe())) + var out bytes.Buffer + markdown.Convert([]byte(""), &out) + + sum := time.Duration(0) + for i := 0; i < n; i++ { + start := time.Now() + out.Reset() + if err := markdown.Convert(source, &out); err != nil { + panic(err) + } + sum += time.Since(start) + } + fmt.Printf("------- goldmark -------\n") + fmt.Printf("file: %s\n", file) + fmt.Printf("iteration: %d\n", n) + fmt.Printf("average: %.10f sec\n", float64((int64(sum)/int64(n)))/1000000000.0) +} diff --git a/_benchmark/go/_data.md b/_benchmark/go/_data.md new file mode 100644 index 0000000..87db650 --- /dev/null +++ b/_benchmark/go/_data.md @@ -0,0 +1,9702 @@ +# Introduction + +## What is Markdown? + +Markdown is a plain text format for writing structured documents, +based on conventions for indicating formatting in email +and usenet posts. It was developed by John Gruber (with +help from Aaron Swartz) and released in 2004 in the form of a +[syntax description](http://daringfireball.net/projects/markdown/syntax) +and a Perl script (`Markdown.pl`) for converting Markdown to +HTML. In the next decade, dozens of implementations were +developed in many languages. Some extended the original +Markdown syntax with conventions for footnotes, tables, and +other document elements. Some allowed Markdown documents to be +rendered in formats other than HTML. Websites like Reddit, +StackOverflow, and GitHub had millions of people using Markdown. +And Markdown started to be used beyond the web, to author books, +articles, slide shows, letters, and lecture notes. + +What distinguishes Markdown from many other lightweight markup +syntaxes, which are often easier to write, is its readability. +As Gruber writes: + +> The overriding design goal for Markdown's formatting syntax is +> to make it as readable as possible. The idea is that a +> Markdown-formatted document should be publishable as-is, as +> plain text, without looking like it's been marked up with tags +> or formatting instructions. +> () + +The point can be illustrated by comparing a sample of +[AsciiDoc](http://www.methods.co.nz/asciidoc/) with +an equivalent sample of Markdown. Here is a sample of +AsciiDoc from the AsciiDoc manual: + +``` +1. List item one. ++ +List item one continued with a second paragraph followed by an +Indented block. ++ +................. +$ ls *.sh +$ mv *.sh ~/tmp +................. ++ +List item continued with a third paragraph. + +2. List item two continued with an open block. ++ +-- +This paragraph is part of the preceding list item. + +a. This list is nested and does not require explicit item +continuation. ++ +This paragraph is part of the preceding list item. + +b. List item b. + +This paragraph belongs to item two of the outer list. +-- +``` + +And here is the equivalent in Markdown: +``` +1. List item one. + + List item one continued with a second paragraph followed by an + Indented block. + + $ ls *.sh + $ mv *.sh ~/tmp + + List item continued with a third paragraph. + +2. List item two continued with an open block. + + This paragraph is part of the preceding list item. + + 1. This list is nested and does not require explicit item continuation. + + This paragraph is part of the preceding list item. + + 2. List item b. + + This paragraph belongs to item two of the outer list. +``` + +The AsciiDoc version is, arguably, easier to write. You don't need +to worry about indentation. But the Markdown version is much easier +to read. The nesting of list items is apparent to the eye in the +source, not just in the processed document. + +## Why is a spec needed? + +John Gruber's [canonical description of Markdown's +syntax](http://daringfireball.net/projects/markdown/syntax) +does not specify the syntax unambiguously. Here are some examples of +questions it does not answer: + +1. How much indentation is needed for a sublist? The spec says that + continuation paragraphs need to be indented four spaces, but is + not fully explicit about sublists. It is natural to think that + they, too, must be indented four spaces, but `Markdown.pl` does + not require that. This is hardly a "corner case," and divergences + between implementations on this issue often lead to surprises for + users in real documents. (See [this comment by John + Gruber](http://article.gmane.org/gmane.text.markdown.general/1997).) + +2. Is a blank line needed before a block quote or heading? + Most implementations do not require the blank line. However, + this can lead to unexpected results in hard-wrapped text, and + also to ambiguities in parsing (note that some implementations + put the heading inside the blockquote, while others do not). + (John Gruber has also spoken [in favor of requiring the blank + lines](http://article.gmane.org/gmane.text.markdown.general/2146).) + +3. Is a blank line needed before an indented code block? + (`Markdown.pl` requires it, but this is not mentioned in the + documentation, and some implementations do not require it.) + + ``` markdown + paragraph + code? + ``` + +4. What is the exact rule for determining when list items get + wrapped in `

` tags? Can a list be partially "loose" and partially + "tight"? What should we do with a list like this? + + ``` markdown + 1. one + + 2. two + 3. three + ``` + + Or this? + + ``` markdown + 1. one + - a + + - b + 2. two + ``` + + (There are some relevant comments by John Gruber + [here](http://article.gmane.org/gmane.text.markdown.general/2554).) + +5. Can list markers be indented? Can ordered list markers be right-aligned? + + ``` markdown + 8. item 1 + 9. item 2 + 10. item 2a + ``` + +6. Is this one list with a thematic break in its second item, + or two lists separated by a thematic break? + + ``` markdown + * a + * * * * * + * b + ``` + +7. When list markers change from numbers to bullets, do we have + two lists or one? (The Markdown syntax description suggests two, + but the perl scripts and many other implementations produce one.) + + ``` markdown + 1. fee + 2. fie + - foe + - fum + ``` + +8. What are the precedence rules for the markers of inline structure? + For example, is the following a valid link, or does the code span + take precedence ? + + ``` markdown + [a backtick (`)](/url) and [another backtick (`)](/url). + ``` + +9. What are the precedence rules for markers of emphasis and strong + emphasis? For example, how should the following be parsed? + + ``` markdown + *foo *bar* baz* + ``` + +10. What are the precedence rules between block-level and inline-level + structure? For example, how should the following be parsed? + + ``` markdown + - `a long code span can contain a hyphen like this + - and it can screw things up` + ``` + +11. Can list items include section headings? (`Markdown.pl` does not + allow this, but does allow blockquotes to include headings.) + + ``` markdown + - # Heading + ``` + +12. Can list items be empty? + + ``` markdown + * a + * + * b + ``` + +13. Can link references be defined inside block quotes or list items? + + ``` markdown + > Blockquote [foo]. + > + > [foo]: /url + ``` + +14. If there are multiple definitions for the same reference, which takes + precedence? + + ``` markdown + [foo]: /url1 + [foo]: /url2 + + [foo][] + ``` + +In the absence of a spec, early implementers consulted `Markdown.pl` +to resolve these ambiguities. But `Markdown.pl` was quite buggy, and +gave manifestly bad results in many cases, so it was not a +satisfactory replacement for a spec. + +Because there is no unambiguous spec, implementations have diverged +considerably. As a result, users are often surprised to find that +a document that renders one way on one system (say, a GitHub wiki) +renders differently on another (say, converting to docbook using +pandoc). To make matters worse, because nothing in Markdown counts +as a "syntax error," the divergence often isn't discovered right away. + +## About this document + +This document attempts to specify Markdown syntax unambiguously. +It contains many examples with side-by-side Markdown and +HTML. These are intended to double as conformance tests. An +accompanying script `spec_tests.py` can be used to run the tests +against any Markdown program: + + python test/spec_tests.py --spec spec.txt --program PROGRAM + +Since this document describes how Markdown is to be parsed into +an abstract syntax tree, it would have made sense to use an abstract +representation of the syntax tree instead of HTML. But HTML is capable +of representing the structural distinctions we need to make, and the +choice of HTML for the tests makes it possible to run the tests against +an implementation without writing an abstract syntax tree renderer. + +This document is generated from a text file, `spec.txt`, written +in Markdown with a small extension for the side-by-side tests. +The script `tools/makespec.py` can be used to convert `spec.txt` into +HTML or CommonMark (which can then be converted into other formats). + +In the examples, the `→` character is used to represent tabs. + +# Preliminaries + +## Characters and lines + +Any sequence of [characters] is a valid CommonMark +document. + +A [character](@) is a Unicode code point. Although some +code points (for example, combining accents) do not correspond to +characters in an intuitive sense, all code points count as characters +for purposes of this spec. + +This spec does not specify an encoding; it thinks of lines as composed +of [characters] rather than bytes. A conforming parser may be limited +to a certain encoding. + +A [line](@) is a sequence of zero or more [characters] +other than newline (`U+000A`) or carriage return (`U+000D`), +followed by a [line ending] or by the end of file. + +A [line ending](@) is a newline (`U+000A`), a carriage return +(`U+000D`) not followed by a newline, or a carriage return and a +following newline. + +A line containing no characters, or a line containing only spaces +(`U+0020`) or tabs (`U+0009`), is called a [blank line](@). + +The following definitions of character classes will be used in this spec: + +A [whitespace character](@) is a space +(`U+0020`), tab (`U+0009`), newline (`U+000A`), line tabulation (`U+000B`), +form feed (`U+000C`), or carriage return (`U+000D`). + +[Whitespace](@) is a sequence of one or more [whitespace +characters]. + +A [Unicode whitespace character](@) is +any code point in the Unicode `Zs` general category, or a tab (`U+0009`), +carriage return (`U+000D`), newline (`U+000A`), or form feed +(`U+000C`). + +[Unicode whitespace](@) is a sequence of one +or more [Unicode whitespace characters]. + +A [space](@) is `U+0020`. + +A [non-whitespace character](@) is any character +that is not a [whitespace character]. + +An [ASCII punctuation character](@) +is `!`, `"`, `#`, `$`, `%`, `&`, `'`, `(`, `)`, +`*`, `+`, `,`, `-`, `.`, `/` (U+0021–2F), +`:`, `;`, `<`, `=`, `>`, `?`, `@` (U+003A–0040), +`[`, `\`, `]`, `^`, `_`, `` ` `` (U+005B–0060), +`{`, `|`, `}`, or `~` (U+007B–007E). + +A [punctuation character](@) is an [ASCII +punctuation character] or anything in +the general Unicode categories `Pc`, `Pd`, `Pe`, `Pf`, `Pi`, `Po`, or `Ps`. + +## Tabs + +Tabs in lines are not expanded to [spaces]. However, +in contexts where whitespace helps to define block structure, +tabs behave as if they were replaced by spaces with a tab stop +of 4 characters. + +Thus, for example, a tab can be used instead of four spaces +in an indented code block. (Note, however, that internal +tabs are passed through as literal tabs, not expanded to +spaces.) + +```````````````````````````````` example +→foo→baz→→bim +. +

foo→baz→→bim
+
+```````````````````````````````` + +```````````````````````````````` example + →foo→baz→→bim +. +
foo→baz→→bim
+
+```````````````````````````````` + +```````````````````````````````` example + a→a + ὐ→a +. +
a→a
+ὐ→a
+
+```````````````````````````````` + +In the following example, a continuation paragraph of a list +item is indented with a tab; this has exactly the same effect +as indentation with four spaces would: + +```````````````````````````````` example + - foo + +→bar +. +
    +
  • +

    foo

    +

    bar

    +
  • +
+```````````````````````````````` + +```````````````````````````````` example +- foo + +→→bar +. +
    +
  • +

    foo

    +
      bar
    +
    +
  • +
+```````````````````````````````` + +Normally the `>` that begins a block quote may be followed +optionally by a space, which is not considered part of the +content. In the following case `>` is followed by a tab, +which is treated as if it were expanded into three spaces. +Since one of these spaces is considered part of the +delimiter, `foo` is considered to be indented six spaces +inside the block quote context, so we get an indented +code block starting with two spaces. + +```````````````````````````````` example +>→→foo +. +
+
  foo
+
+
+```````````````````````````````` + +```````````````````````````````` example +-→→foo +. +
    +
  • +
      foo
    +
    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example + foo +→bar +. +
foo
+bar
+
+```````````````````````````````` + +```````````````````````````````` example + - foo + - bar +→ - baz +. +
    +
  • foo +
      +
    • bar +
        +
      • baz
      • +
      +
    • +
    +
  • +
+```````````````````````````````` + +```````````````````````````````` example +#→Foo +. +

Foo

+```````````````````````````````` + +```````````````````````````````` example +*→*→*→ +. +
+```````````````````````````````` + + +## Insecure characters + +For security reasons, the Unicode character `U+0000` must be replaced +with the REPLACEMENT CHARACTER (`U+FFFD`). + +# Blocks and inlines + +We can think of a document as a sequence of +[blocks](@)---structural elements like paragraphs, block +quotations, lists, headings, rules, and code blocks. Some blocks (like +block quotes and list items) contain other blocks; others (like +headings and paragraphs) contain [inline](@) content---text, +links, emphasized text, images, code spans, and so on. + +## Precedence + +Indicators of block structure always take precedence over indicators +of inline structure. So, for example, the following is a list with +two items, not a list with one item containing a code span: + +```````````````````````````````` example +- `one +- two` +. +
    +
  • `one
  • +
  • two`
  • +
+```````````````````````````````` + + +This means that parsing can proceed in two steps: first, the block +structure of the document can be discerned; second, text lines inside +paragraphs, headings, and other block constructs can be parsed for inline +structure. The second step requires information about link reference +definitions that will be available only at the end of the first +step. Note that the first step requires processing lines in sequence, +but the second can be parallelized, since the inline parsing of +one block element does not affect the inline parsing of any other. + +## Container blocks and leaf blocks + +We can divide blocks into two types: +[container blocks](@), +which can contain other blocks, and [leaf blocks](@), +which cannot. + +# Leaf blocks + +This section describes the different kinds of leaf block that make up a +Markdown document. + +## Thematic breaks + +A line consisting of 0-3 spaces of indentation, followed by a sequence +of three or more matching `-`, `_`, or `*` characters, each followed +optionally by any number of spaces or tabs, forms a +[thematic break](@). + +```````````````````````````````` example +*** +--- +___ +. +
+
+
+```````````````````````````````` + + +Wrong characters: + +```````````````````````````````` example ++++ +. +

+++

+```````````````````````````````` + + +```````````````````````````````` example +=== +. +

===

+```````````````````````````````` + + +Not enough characters: + +```````````````````````````````` example +-- +** +__ +. +

-- +** +__

+```````````````````````````````` + + +One to three spaces indent are allowed: + +```````````````````````````````` example + *** + *** + *** +. +
+
+
+```````````````````````````````` + + +Four spaces is too many: + +```````````````````````````````` example + *** +. +
***
+
+```````````````````````````````` + + +```````````````````````````````` example +Foo + *** +. +

Foo +***

+```````````````````````````````` + + +More than three characters may be used: + +```````````````````````````````` example +_____________________________________ +. +
+```````````````````````````````` + + +Spaces are allowed between the characters: + +```````````````````````````````` example + - - - +. +
+```````````````````````````````` + + +```````````````````````````````` example + ** * ** * ** * ** +. +
+```````````````````````````````` + + +```````````````````````````````` example +- - - - +. +
+```````````````````````````````` + + +Spaces are allowed at the end: + +```````````````````````````````` example +- - - - +. +
+```````````````````````````````` + + +However, no other characters may occur in the line: + +```````````````````````````````` example +_ _ _ _ a + +a------ + +---a--- +. +

_ _ _ _ a

+

a------

+

---a---

+```````````````````````````````` + + +It is required that all of the [non-whitespace characters] be the same. +So, this is not a thematic break: + +```````````````````````````````` example + *-* +. +

-

+```````````````````````````````` + + +Thematic breaks do not need blank lines before or after: + +```````````````````````````````` example +- foo +*** +- bar +. +
    +
  • foo
  • +
+
+
    +
  • bar
  • +
+```````````````````````````````` + + +Thematic breaks can interrupt a paragraph: + +```````````````````````````````` example +Foo +*** +bar +. +

Foo

+
+

bar

+```````````````````````````````` + + +If a line of dashes that meets the above conditions for being a +thematic break could also be interpreted as the underline of a [setext +heading], the interpretation as a +[setext heading] takes precedence. Thus, for example, +this is a setext heading, not a paragraph followed by a thematic break: + +```````````````````````````````` example +Foo +--- +bar +. +

Foo

+

bar

+```````````````````````````````` + + +When both a thematic break and a list item are possible +interpretations of a line, the thematic break takes precedence: + +```````````````````````````````` example +* Foo +* * * +* Bar +. +
    +
  • Foo
  • +
+
+
    +
  • Bar
  • +
+```````````````````````````````` + + +If you want a thematic break in a list item, use a different bullet: + +```````````````````````````````` example +- Foo +- * * * +. +
    +
  • Foo
  • +
  • +
    +
  • +
+```````````````````````````````` + + +## ATX headings + +An [ATX heading](@) +consists of a string of characters, parsed as inline content, between an +opening sequence of 1--6 unescaped `#` characters and an optional +closing sequence of any number of unescaped `#` characters. +The opening sequence of `#` characters must be followed by a +[space] or by the end of line. The optional closing sequence of `#`s must be +preceded by a [space] and may be followed by spaces only. The opening +`#` character may be indented 0-3 spaces. The raw contents of the +heading are stripped of leading and trailing spaces before being parsed +as inline content. The heading level is equal to the number of `#` +characters in the opening sequence. + +Simple headings: + +```````````````````````````````` example +# foo +## foo +### foo +#### foo +##### foo +###### foo +. +

foo

+

foo

+

foo

+

foo

+
foo
+
foo
+```````````````````````````````` + + +More than six `#` characters is not a heading: + +```````````````````````````````` example +####### foo +. +

####### foo

+```````````````````````````````` + + +At least one space is required between the `#` characters and the +heading's contents, unless the heading is empty. Note that many +implementations currently do not require the space. However, the +space was required by the +[original ATX implementation](http://www.aaronsw.com/2002/atx/atx.py), +and it helps prevent things like the following from being parsed as +headings: + +```````````````````````````````` example +#5 bolt + +#hashtag +. +

#5 bolt

+

#hashtag

+```````````````````````````````` + + +This is not a heading, because the first `#` is escaped: + +```````````````````````````````` example +\## foo +. +

## foo

+```````````````````````````````` + + +Contents are parsed as inlines: + +```````````````````````````````` example +# foo *bar* \*baz\* +. +

foo bar *baz*

+```````````````````````````````` + + +Leading and trailing [whitespace] is ignored in parsing inline content: + +```````````````````````````````` example +# foo +. +

foo

+```````````````````````````````` + + +One to three spaces indentation are allowed: + +```````````````````````````````` example + ### foo + ## foo + # foo +. +

foo

+

foo

+

foo

+```````````````````````````````` + + +Four spaces are too much: + +```````````````````````````````` example + # foo +. +
# foo
+
+```````````````````````````````` + + +```````````````````````````````` example +foo + # bar +. +

foo +# bar

+```````````````````````````````` + + +A closing sequence of `#` characters is optional: + +```````````````````````````````` example +## foo ## + ### bar ### +. +

foo

+

bar

+```````````````````````````````` + + +It need not be the same length as the opening sequence: + +```````````````````````````````` example +# foo ################################## +##### foo ## +. +

foo

+
foo
+```````````````````````````````` + + +Spaces are allowed after the closing sequence: + +```````````````````````````````` example +### foo ### +. +

foo

+```````````````````````````````` + + +A sequence of `#` characters with anything but [spaces] following it +is not a closing sequence, but counts as part of the contents of the +heading: + +```````````````````````````````` example +### foo ### b +. +

foo ### b

+```````````````````````````````` + + +The closing sequence must be preceded by a space: + +```````````````````````````````` example +# foo# +. +

foo#

+```````````````````````````````` + + +Backslash-escaped `#` characters do not count as part +of the closing sequence: + +```````````````````````````````` example +### foo \### +## foo #\## +# foo \# +. +

foo ###

+

foo ###

+

foo #

+```````````````````````````````` + + +ATX headings need not be separated from surrounding content by blank +lines, and they can interrupt paragraphs: + +```````````````````````````````` example +**** +## foo +**** +. +
+

foo

+
+```````````````````````````````` + + +```````````````````````````````` example +Foo bar +# baz +Bar foo +. +

Foo bar

+

baz

+

Bar foo

+```````````````````````````````` + + +ATX headings can be empty: + +```````````````````````````````` example +## +# +### ### +. +

+

+

+```````````````````````````````` + + +## Setext headings + +A [setext heading](@) consists of one or more +lines of text, each containing at least one [non-whitespace +character], with no more than 3 spaces indentation, followed by +a [setext heading underline]. The lines of text must be such +that, were they not followed by the setext heading underline, +they would be interpreted as a paragraph: they cannot be +interpretable as a [code fence], [ATX heading][ATX headings], +[block quote][block quotes], [thematic break][thematic breaks], +[list item][list items], or [HTML block][HTML blocks]. + +A [setext heading underline](@) is a sequence of +`=` characters or a sequence of `-` characters, with no more than 3 +spaces indentation and any number of trailing spaces. If a line +containing a single `-` can be interpreted as an +empty [list items], it should be interpreted this way +and not as a [setext heading underline]. + +The heading is a level 1 heading if `=` characters are used in +the [setext heading underline], and a level 2 heading if `-` +characters are used. The contents of the heading are the result +of parsing the preceding lines of text as CommonMark inline +content. + +In general, a setext heading need not be preceded or followed by a +blank line. However, it cannot interrupt a paragraph, so when a +setext heading comes after a paragraph, a blank line is needed between +them. + +Simple examples: + +```````````````````````````````` example +Foo *bar* +========= + +Foo *bar* +--------- +. +

Foo bar

+

Foo bar

+```````````````````````````````` + + +The content of the header may span more than one line: + +```````````````````````````````` example +Foo *bar +baz* +==== +. +

Foo bar +baz

+```````````````````````````````` + +The contents are the result of parsing the headings's raw +content as inlines. The heading's raw content is formed by +concatenating the lines and removing initial and final +[whitespace]. + +```````````````````````````````` example + Foo *bar +baz*→ +==== +. +

Foo bar +baz

+```````````````````````````````` + + +The underlining can be any length: + +```````````````````````````````` example +Foo +------------------------- + +Foo += +. +

Foo

+

Foo

+```````````````````````````````` + + +The heading content can be indented up to three spaces, and need +not line up with the underlining: + +```````````````````````````````` example + Foo +--- + + Foo +----- + + Foo + === +. +

Foo

+

Foo

+

Foo

+```````````````````````````````` + + +Four spaces indent is too much: + +```````````````````````````````` example + Foo + --- + + Foo +--- +. +
Foo
+---
+
+Foo
+
+
+```````````````````````````````` + + +The setext heading underline can be indented up to three spaces, and +may have trailing spaces: + +```````````````````````````````` example +Foo + ---- +. +

Foo

+```````````````````````````````` + + +Four spaces is too much: + +```````````````````````````````` example +Foo + --- +. +

Foo +---

+```````````````````````````````` + + +The setext heading underline cannot contain internal spaces: + +```````````````````````````````` example +Foo += = + +Foo +--- - +. +

Foo += =

+

Foo

+
+```````````````````````````````` + + +Trailing spaces in the content line do not cause a line break: + +```````````````````````````````` example +Foo +----- +. +

Foo

+```````````````````````````````` + + +Nor does a backslash at the end: + +```````````````````````````````` example +Foo\ +---- +. +

Foo\

+```````````````````````````````` + + +Since indicators of block structure take precedence over +indicators of inline structure, the following are setext headings: + +```````````````````````````````` example +`Foo +---- +` + +
+. +

`Foo

+

`

+

<a title="a lot

+

of dashes"/>

+```````````````````````````````` + + +The setext heading underline cannot be a [lazy continuation +line] in a list item or block quote: + +```````````````````````````````` example +> Foo +--- +. +
+

Foo

+
+
+```````````````````````````````` + + +```````````````````````````````` example +> foo +bar +=== +. +
+

foo +bar +===

+
+```````````````````````````````` + + +```````````````````````````````` example +- Foo +--- +. +
    +
  • Foo
  • +
+
+```````````````````````````````` + + +A blank line is needed between a paragraph and a following +setext heading, since otherwise the paragraph becomes part +of the heading's content: + +```````````````````````````````` example +Foo +Bar +--- +. +

Foo +Bar

+```````````````````````````````` + + +But in general a blank line is not required before or after +setext headings: + +```````````````````````````````` example +--- +Foo +--- +Bar +--- +Baz +. +
+

Foo

+

Bar

+

Baz

+```````````````````````````````` + + +Setext headings cannot be empty: + +```````````````````````````````` example + +==== +. +

====

+```````````````````````````````` + + +Setext heading text lines must not be interpretable as block +constructs other than paragraphs. So, the line of dashes +in these examples gets interpreted as a thematic break: + +```````````````````````````````` example +--- +--- +. +
+
+```````````````````````````````` + + +```````````````````````````````` example +- foo +----- +. +
    +
  • foo
  • +
+
+```````````````````````````````` + + +```````````````````````````````` example + foo +--- +. +
foo
+
+
+```````````````````````````````` + + +```````````````````````````````` example +> foo +----- +. +
+

foo

+
+
+```````````````````````````````` + + +If you want a heading with `> foo` as its literal text, you can +use backslash escapes: + +```````````````````````````````` example +\> foo +------ +. +

> foo

+```````````````````````````````` + + +**Compatibility note:** Most existing Markdown implementations +do not allow the text of setext headings to span multiple lines. +But there is no consensus about how to interpret + +``` markdown +Foo +bar +--- +baz +``` + +One can find four different interpretations: + +1. paragraph "Foo", heading "bar", paragraph "baz" +2. paragraph "Foo bar", thematic break, paragraph "baz" +3. paragraph "Foo bar --- baz" +4. heading "Foo bar", paragraph "baz" + +We find interpretation 4 most natural, and interpretation 4 +increases the expressive power of CommonMark, by allowing +multiline headings. Authors who want interpretation 1 can +put a blank line after the first paragraph: + +```````````````````````````````` example +Foo + +bar +--- +baz +. +

Foo

+

bar

+

baz

+```````````````````````````````` + + +Authors who want interpretation 2 can put blank lines around +the thematic break, + +```````````````````````````````` example +Foo +bar + +--- + +baz +. +

Foo +bar

+
+

baz

+```````````````````````````````` + + +or use a thematic break that cannot count as a [setext heading +underline], such as + +```````````````````````````````` example +Foo +bar +* * * +baz +. +

Foo +bar

+
+

baz

+```````````````````````````````` + + +Authors who want interpretation 3 can use backslash escapes: + +```````````````````````````````` example +Foo +bar +\--- +baz +. +

Foo +bar +--- +baz

+```````````````````````````````` + + +## Indented code blocks + +An [indented code block](@) is composed of one or more +[indented chunks] separated by blank lines. +An [indented chunk](@) is a sequence of non-blank lines, +each indented four or more spaces. The contents of the code block are +the literal contents of the lines, including trailing +[line endings], minus four spaces of indentation. +An indented code block has no [info string]. + +An indented code block cannot interrupt a paragraph, so there must be +a blank line between a paragraph and a following indented code block. +(A blank line is not needed, however, between a code block and a following +paragraph.) + +```````````````````````````````` example + a simple + indented code block +. +
a simple
+  indented code block
+
+```````````````````````````````` + + +If there is any ambiguity between an interpretation of indentation +as a code block and as indicating that material belongs to a [list +item][list items], the list item interpretation takes precedence: + +```````````````````````````````` example + - foo + + bar +. +
    +
  • +

    foo

    +

    bar

    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example +1. foo + + - bar +. +
    +
  1. +

    foo

    +
      +
    • bar
    • +
    +
  2. +
+```````````````````````````````` + + + +The contents of a code block are literal text, and do not get parsed +as Markdown: + +```````````````````````````````` example +
+ *hi* + + - one +. +
<a/>
+*hi*
+
+- one
+
+```````````````````````````````` + + +Here we have three chunks separated by blank lines: + +```````````````````````````````` example + chunk1 + + chunk2 + + + + chunk3 +. +
chunk1
+
+chunk2
+
+
+
+chunk3
+
+```````````````````````````````` + + +Any initial spaces beyond four will be included in the content, even +in interior blank lines: + +```````````````````````````````` example + chunk1 + + chunk2 +. +
chunk1
+  
+  chunk2
+
+```````````````````````````````` + + +An indented code block cannot interrupt a paragraph. (This +allows hanging indents and the like.) + +```````````````````````````````` example +Foo + bar + +. +

Foo +bar

+```````````````````````````````` + + +However, any non-blank line with fewer than four leading spaces ends +the code block immediately. So a paragraph may occur immediately +after indented code: + +```````````````````````````````` example + foo +bar +. +
foo
+
+

bar

+```````````````````````````````` + + +And indented code can occur immediately before and after other kinds of +blocks: + +```````````````````````````````` example +# Heading + foo +Heading +------ + foo +---- +. +

Heading

+
foo
+
+

Heading

+
foo
+
+
+```````````````````````````````` + + +The first line can be indented more than four spaces: + +```````````````````````````````` example + foo + bar +. +
    foo
+bar
+
+```````````````````````````````` + + +Blank lines preceding or following an indented code block +are not included in it: + +```````````````````````````````` example + + + foo + + +. +
foo
+
+```````````````````````````````` + + +Trailing spaces are included in the code block's content: + +```````````````````````````````` example + foo +. +
foo  
+
+```````````````````````````````` + + + +## Fenced code blocks + +A [code fence](@) is a sequence +of at least three consecutive backtick characters (`` ` ``) or +tildes (`~`). (Tildes and backticks cannot be mixed.) +A [fenced code block](@) +begins with a code fence, indented no more than three spaces. + +The line with the opening code fence may optionally contain some text +following the code fence; this is trimmed of leading and trailing +whitespace and called the [info string](@). If the [info string] comes +after a backtick fence, it may not contain any backtick +characters. (The reason for this restriction is that otherwise +some inline code would be incorrectly interpreted as the +beginning of a fenced code block.) + +The content of the code block consists of all subsequent lines, until +a closing [code fence] of the same type as the code block +began with (backticks or tildes), and with at least as many backticks +or tildes as the opening code fence. If the leading code fence is +indented N spaces, then up to N spaces of indentation are removed from +each line of the content (if present). (If a content line is not +indented, it is preserved unchanged. If it is indented less than N +spaces, all of the indentation is removed.) + +The closing code fence may be indented up to three spaces, and may be +followed only by spaces, which are ignored. If the end of the +containing block (or document) is reached and no closing code fence +has been found, the code block contains all of the lines after the +opening code fence until the end of the containing block (or +document). (An alternative spec would require backtracking in the +event that a closing code fence is not found. But this makes parsing +much less efficient, and there seems to be no real down side to the +behavior described here.) + +A fenced code block may interrupt a paragraph, and does not require +a blank line either before or after. + +The content of a code fence is treated as literal text, not parsed +as inlines. The first word of the [info string] is typically used to +specify the language of the code sample, and rendered in the `class` +attribute of the `code` tag. However, this spec does not mandate any +particular treatment of the [info string]. + +Here is a simple example with backticks: + +```````````````````````````````` example +``` +< + > +``` +. +
<
+ >
+
+```````````````````````````````` + + +With tildes: + +```````````````````````````````` example +~~~ +< + > +~~~ +. +
<
+ >
+
+```````````````````````````````` + +Fewer than three backticks is not enough: + +```````````````````````````````` example +`` +foo +`` +. +

foo

+```````````````````````````````` + +The closing code fence must use the same character as the opening +fence: + +```````````````````````````````` example +``` +aaa +~~~ +``` +. +
aaa
+~~~
+
+```````````````````````````````` + + +```````````````````````````````` example +~~~ +aaa +``` +~~~ +. +
aaa
+```
+
+```````````````````````````````` + + +The closing code fence must be at least as long as the opening fence: + +```````````````````````````````` example +```` +aaa +``` +`````` +. +
aaa
+```
+
+```````````````````````````````` + + +```````````````````````````````` example +~~~~ +aaa +~~~ +~~~~ +. +
aaa
+~~~
+
+```````````````````````````````` + + +Unclosed code blocks are closed by the end of the document +(or the enclosing [block quote][block quotes] or [list item][list items]): + +```````````````````````````````` example +``` +. +
+```````````````````````````````` + + +```````````````````````````````` example +````` + +``` +aaa +. +

+```
+aaa
+
+```````````````````````````````` + + +```````````````````````````````` example +> ``` +> aaa + +bbb +. +
+
aaa
+
+
+

bbb

+```````````````````````````````` + + +A code block can have all empty lines as its content: + +```````````````````````````````` example +``` + + +``` +. +

+  
+
+```````````````````````````````` + + +A code block can be empty: + +```````````````````````````````` example +``` +``` +. +
+```````````````````````````````` + + +Fences can be indented. If the opening fence is indented, +content lines will have equivalent opening indentation removed, +if present: + +```````````````````````````````` example + ``` + aaa +aaa +``` +. +
aaa
+aaa
+
+```````````````````````````````` + + +```````````````````````````````` example + ``` +aaa + aaa +aaa + ``` +. +
aaa
+aaa
+aaa
+
+```````````````````````````````` + + +```````````````````````````````` example + ``` + aaa + aaa + aaa + ``` +. +
aaa
+ aaa
+aaa
+
+```````````````````````````````` + + +Four spaces indentation produces an indented code block: + +```````````````````````````````` example + ``` + aaa + ``` +. +
```
+aaa
+```
+
+```````````````````````````````` + + +Closing fences may be indented by 0-3 spaces, and their indentation +need not match that of the opening fence: + +```````````````````````````````` example +``` +aaa + ``` +. +
aaa
+
+```````````````````````````````` + + +```````````````````````````````` example + ``` +aaa + ``` +. +
aaa
+
+```````````````````````````````` + + +This is not a closing fence, because it is indented 4 spaces: + +```````````````````````````````` example +``` +aaa + ``` +. +
aaa
+    ```
+
+```````````````````````````````` + + + +Code fences (opening and closing) cannot contain internal spaces: + +```````````````````````````````` example +``` ``` +aaa +. +

+aaa

+```````````````````````````````` + + +```````````````````````````````` example +~~~~~~ +aaa +~~~ ~~ +. +
aaa
+~~~ ~~
+
+```````````````````````````````` + + +Fenced code blocks can interrupt paragraphs, and can be followed +directly by paragraphs, without a blank line between: + +```````````````````````````````` example +foo +``` +bar +``` +baz +. +

foo

+
bar
+
+

baz

+```````````````````````````````` + + +Other blocks can also occur before and after fenced code blocks +without an intervening blank line: + +```````````````````````````````` example +foo +--- +~~~ +bar +~~~ +# baz +. +

foo

+
bar
+
+

baz

+```````````````````````````````` + + +An [info string] can be provided after the opening code fence. +Although this spec doesn't mandate any particular treatment of +the info string, the first word is typically used to specify +the language of the code block. In HTML output, the language is +normally indicated by adding a class to the `code` element consisting +of `language-` followed by the language name. + +```````````````````````````````` example +```ruby +def foo(x) + return 3 +end +``` +. +
def foo(x)
+  return 3
+end
+
+```````````````````````````````` + + +```````````````````````````````` example +~~~~ ruby startline=3 $%@#$ +def foo(x) + return 3 +end +~~~~~~~ +. +
def foo(x)
+  return 3
+end
+
+```````````````````````````````` + + +```````````````````````````````` example +````; +```` +. +
+```````````````````````````````` + + +[Info strings] for backtick code blocks cannot contain backticks: + +```````````````````````````````` example +``` aa ``` +foo +. +

aa +foo

+```````````````````````````````` + + +[Info strings] for tilde code blocks can contain backticks and tildes: + +```````````````````````````````` example +~~~ aa ``` ~~~ +foo +~~~ +. +
foo
+
+```````````````````````````````` + + +Closing code fences cannot have [info strings]: + +```````````````````````````````` example +``` +``` aaa +``` +. +
``` aaa
+
+```````````````````````````````` + + + +## HTML blocks + +An [HTML block](@) is a group of lines that is treated +as raw HTML (and will not be escaped in HTML output). + +There are seven kinds of [HTML block], which can be defined by their +start and end conditions. The block begins with a line that meets a +[start condition](@) (after up to three spaces optional indentation). +It ends with the first subsequent line that meets a matching [end +condition](@), or the last line of the document, or the last line of +the [container block](#container-blocks) containing the current HTML +block, if no line is encountered that meets the [end condition]. If +the first line meets both the [start condition] and the [end +condition], the block will contain just that line. + +1. **Start condition:** line begins with the string ``, or the end of the line.\ +**End condition:** line contains an end tag +``, `
`, or `` (case-insensitive; it +need not match the start tag). + +2. **Start condition:** line begins with the string ``. + +3. **Start condition:** line begins with the string ``. + +4. **Start condition:** line begins with the string ``. + +5. **Start condition:** line begins with the string +``. + +6. **Start condition:** line begins the string `<` or ``, or +the string `/>`.\ +**End condition:** line is followed by a [blank line]. + +7. **Start condition:** line begins with a complete [open tag] +(with any [tag name] other than `script`, +`style`, or `pre`) or a complete [closing tag], +followed only by [whitespace] or the end of the line.\ +**End condition:** line is followed by a [blank line]. + +HTML blocks continue until they are closed by their appropriate +[end condition], or the last line of the document or other [container +block](#container-blocks). This means any HTML **within an HTML +block** that might otherwise be recognised as a start condition will +be ignored by the parser and passed through as-is, without changing +the parser's state. + +For instance, `
` within a HTML block started by `` will not affect
+the parser state; as the HTML block was started in by start condition 6, it
+will end at any blank line. This can be surprising:
+
+```````````````````````````````` example
+
+
+**Hello**,
+
+_world_.
+
+
+. +
+
+**Hello**,
+

world. +

+
+```````````````````````````````` + +In this case, the HTML block is terminated by the newline — the `**Hello**` +text remains verbatim — and regular parsing resumes, with a paragraph, +emphasised `world` and inline and block HTML following. + +All types of [HTML blocks] except type 7 may interrupt +a paragraph. Blocks of type 7 may not interrupt a paragraph. +(This restriction is intended to prevent unwanted interpretation +of long tags inside a wrapped paragraph as starting HTML blocks.) + +Some simple examples follow. Here are some basic HTML blocks +of type 6: + +```````````````````````````````` example + + + + +
+ hi +
+ +okay. +. + + + + +
+ hi +
+

okay.

+```````````````````````````````` + + +```````````````````````````````` example +
+*foo* +```````````````````````````````` + + +Here we have two HTML blocks with a Markdown paragraph between them: + +```````````````````````````````` example +
+ +*Markdown* + +
+. +
+

Markdown

+
+```````````````````````````````` + + +The tag on the first line can be partial, as long +as it is split where there would be whitespace: + +```````````````````````````````` example +
+
+. +
+
+```````````````````````````````` + + +```````````````````````````````` example +
+
+. +
+
+```````````````````````````````` + + +An open tag need not be closed: +```````````````````````````````` example +
+*foo* + +*bar* +. +
+*foo* +

bar

+```````````````````````````````` + + + +A partial tag need not even be completed (garbage +in, garbage out): + +```````````````````````````````` example +
+. + +```````````````````````````````` + + +```````````````````````````````` example +
+foo +
+. +
+foo +
+```````````````````````````````` + + +Everything until the next blank line or end of document +gets included in the HTML block. So, in the following +example, what looks like a Markdown code block +is actually part of the HTML block, which continues until a blank +line or the end of the document is reached: + +```````````````````````````````` example +
+``` c +int x = 33; +``` +. +
+``` c +int x = 33; +``` +```````````````````````````````` + + +To start an [HTML block] with a tag that is *not* in the +list of block-level tags in (6), you must put the tag by +itself on the first line (and it must be complete): + +```````````````````````````````` example + +*bar* + +. + +*bar* + +```````````````````````````````` + + +In type 7 blocks, the [tag name] can be anything: + +```````````````````````````````` example + +*bar* + +. + +*bar* + +```````````````````````````````` + + +```````````````````````````````` example + +*bar* + +. + +*bar* + +```````````````````````````````` + + +```````````````````````````````` example + +*bar* +. + +*bar* +```````````````````````````````` + + +These rules are designed to allow us to work with tags that +can function as either block-level or inline-level tags. +The `` tag is a nice example. We can surround content with +`` tags in three different ways. In this case, we get a raw +HTML block, because the `` tag is on a line by itself: + +```````````````````````````````` example + +*foo* + +. + +*foo* + +```````````````````````````````` + + +In this case, we get a raw HTML block that just includes +the `` tag (because it ends with the following blank +line). So the contents get interpreted as CommonMark: + +```````````````````````````````` example + + +*foo* + + +. + +

foo

+
+```````````````````````````````` + + +Finally, in this case, the `` tags are interpreted +as [raw HTML] *inside* the CommonMark paragraph. (Because +the tag is not on a line by itself, we get inline HTML +rather than an [HTML block].) + +```````````````````````````````` example +*foo* +. +

foo

+```````````````````````````````` + + +HTML tags designed to contain literal content +(`script`, `style`, `pre`), comments, processing instructions, +and declarations are treated somewhat differently. +Instead of ending at the first blank line, these blocks +end at the first line containing a corresponding end tag. +As a result, these blocks can contain blank lines: + +A pre tag (type 1): + +```````````````````````````````` example +

+import Text.HTML.TagSoup
+
+main :: IO ()
+main = print $ parseTags tags
+
+okay +. +

+import Text.HTML.TagSoup
+
+main :: IO ()
+main = print $ parseTags tags
+
+

okay

+```````````````````````````````` + + +A script tag (type 1): + +```````````````````````````````` example + +okay +. + +

okay

+```````````````````````````````` + + +A style tag (type 1): + +```````````````````````````````` example + +okay +. + +

okay

+```````````````````````````````` + + +If there is no matching end tag, the block will end at the +end of the document (or the enclosing [block quote][block quotes] +or [list item][list items]): + +```````````````````````````````` example + +*foo* +. + +

foo

+```````````````````````````````` + + +```````````````````````````````` example +*bar* +*baz* +. +*bar* +

baz

+```````````````````````````````` + + +Note that anything on the last line after the +end tag will be included in the [HTML block]: + +```````````````````````````````` example +1. *bar* +. +1. *bar* +```````````````````````````````` + + +A comment (type 2): + +```````````````````````````````` example + +okay +. + +

okay

+```````````````````````````````` + + + +A processing instruction (type 3): + +```````````````````````````````` example +'; + +?> +okay +. +'; + +?> +

okay

+```````````````````````````````` + + +A declaration (type 4): + +```````````````````````````````` example + +. + +```````````````````````````````` + + +CDATA (type 5): + +```````````````````````````````` example + +okay +. + +

okay

+```````````````````````````````` + + +The opening tag can be indented 1-3 spaces, but not 4: + +```````````````````````````````` example + + + +. + +
<!-- foo -->
+
+```````````````````````````````` + + +```````````````````````````````` example +
+ +
+. +
+
<div>
+
+```````````````````````````````` + + +An HTML block of types 1--6 can interrupt a paragraph, and need not be +preceded by a blank line. + +```````````````````````````````` example +Foo +
+bar +
+. +

Foo

+
+bar +
+```````````````````````````````` + + +However, a following blank line is needed, except at the end of +a document, and except for blocks of types 1--5, [above][HTML +block]: + +```````````````````````````````` example +
+bar +
+*foo* +. +
+bar +
+*foo* +```````````````````````````````` + + +HTML blocks of type 7 cannot interrupt a paragraph: + +```````````````````````````````` example +Foo + +baz +. +

Foo + +baz

+```````````````````````````````` + + +This rule differs from John Gruber's original Markdown syntax +specification, which says: + +> The only restrictions are that block-level HTML elements — +> e.g. `
`, ``, `
`, `

`, etc. — must be separated from +> surrounding content by blank lines, and the start and end tags of the +> block should not be indented with tabs or spaces. + +In some ways Gruber's rule is more restrictive than the one given +here: + +- It requires that an HTML block be preceded by a blank line. +- It does not allow the start tag to be indented. +- It requires a matching end tag, which it also does not allow to + be indented. + +Most Markdown implementations (including some of Gruber's own) do not +respect all of these restrictions. + +There is one respect, however, in which Gruber's rule is more liberal +than the one given here, since it allows blank lines to occur inside +an HTML block. There are two reasons for disallowing them here. +First, it removes the need to parse balanced tags, which is +expensive and can require backtracking from the end of the document +if no matching end tag is found. Second, it provides a very simple +and flexible way of including Markdown content inside HTML tags: +simply separate the Markdown from the HTML using blank lines: + +Compare: + +```````````````````````````````` example +

+ +*Emphasized* text. + +
+. +
+

Emphasized text.

+
+```````````````````````````````` + + +```````````````````````````````` example +
+*Emphasized* text. +
+. +
+*Emphasized* text. +
+```````````````````````````````` + + +Some Markdown implementations have adopted a convention of +interpreting content inside tags as text if the open tag has +the attribute `markdown=1`. The rule given above seems a simpler and +more elegant way of achieving the same expressive power, which is also +much simpler to parse. + +The main potential drawback is that one can no longer paste HTML +blocks into Markdown documents with 100% reliability. However, +*in most cases* this will work fine, because the blank lines in +HTML are usually followed by HTML block tags. For example: + +```````````````````````````````` example +
+ + + + + + + +
+Hi +
+. + + + + +
+Hi +
+```````````````````````````````` + + +There are problems, however, if the inner tags are indented +*and* separated by spaces, as then they will be interpreted as +an indented code block: + +```````````````````````````````` example + + + + + + + + +
+ Hi +
+. + + +
<td>
+  Hi
+</td>
+
+ +
+```````````````````````````````` + + +Fortunately, blank lines are usually not necessary and can be +deleted. The exception is inside `
` tags, but as described
+[above][HTML blocks], raw HTML blocks starting with `
`
+*can* contain blank lines.
+
+## Link reference definitions
+
+A [link reference definition](@)
+consists of a [link label], indented up to three spaces, followed
+by a colon (`:`), optional [whitespace] (including up to one
+[line ending]), a [link destination],
+optional [whitespace] (including up to one
+[line ending]), and an optional [link
+title], which if it is present must be separated
+from the [link destination] by [whitespace].
+No further [non-whitespace characters] may occur on the line.
+
+A [link reference definition]
+does not correspond to a structural element of a document.  Instead, it
+defines a label which can be used in [reference links]
+and reference-style [images] elsewhere in the document.  [Link
+reference definitions] can come either before or after the links that use
+them.
+
+```````````````````````````````` example
+[foo]: /url "title"
+
+[foo]
+.
+

foo

+```````````````````````````````` + + +```````````````````````````````` example + [foo]: + /url + 'the title' + +[foo] +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[Foo*bar\]]:my_(url) 'title (with parens)' + +[Foo*bar\]] +. +

Foo*bar]

+```````````````````````````````` + + +```````````````````````````````` example +[Foo bar]: + +'title' + +[Foo bar] +. +

Foo bar

+```````````````````````````````` + + +The title may extend over multiple lines: + +```````````````````````````````` example +[foo]: /url ' +title +line1 +line2 +' + +[foo] +. +

foo

+```````````````````````````````` + + +However, it may not contain a [blank line]: + +```````````````````````````````` example +[foo]: /url 'title + +with blank line' + +[foo] +. +

[foo]: /url 'title

+

with blank line'

+

[foo]

+```````````````````````````````` + + +The title may be omitted: + +```````````````````````````````` example +[foo]: +/url + +[foo] +. +

foo

+```````````````````````````````` + + +The link destination may not be omitted: + +```````````````````````````````` example +[foo]: + +[foo] +. +

[foo]:

+

[foo]

+```````````````````````````````` + + However, an empty link destination may be specified using + angle brackets: + +```````````````````````````````` example +[foo]: <> + +[foo] +. +

foo

+```````````````````````````````` + +The title must be separated from the link destination by +whitespace: + +```````````````````````````````` example +[foo]: (baz) + +[foo] +. +

[foo]: (baz)

+

[foo]

+```````````````````````````````` + + +Both title and destination can contain backslash escapes +and literal backslashes: + +```````````````````````````````` example +[foo]: /url\bar\*baz "foo\"bar\baz" + +[foo] +. +

foo

+```````````````````````````````` + + +A link can come before its corresponding definition: + +```````````````````````````````` example +[foo] + +[foo]: url +. +

foo

+```````````````````````````````` + + +If there are several matching definitions, the first one takes +precedence: + +```````````````````````````````` example +[foo] + +[foo]: first +[foo]: second +. +

foo

+```````````````````````````````` + + +As noted in the section on [Links], matching of labels is +case-insensitive (see [matches]). + +```````````````````````````````` example +[FOO]: /url + +[Foo] +. +

Foo

+```````````````````````````````` + + +```````````````````````````````` example +[ΑΓΩ]: /φου + +[αγω] +. +

αγω

+```````````````````````````````` + + +Here is a link reference definition with no corresponding link. +It contributes nothing to the document. + +```````````````````````````````` example +[foo]: /url +. +```````````````````````````````` + + +Here is another one: + +```````````````````````````````` example +[ +foo +]: /url +bar +. +

bar

+```````````````````````````````` + + +This is not a link reference definition, because there are +[non-whitespace characters] after the title: + +```````````````````````````````` example +[foo]: /url "title" ok +. +

[foo]: /url "title" ok

+```````````````````````````````` + + +This is a link reference definition, but it has no title: + +```````````````````````````````` example +[foo]: /url +"title" ok +. +

"title" ok

+```````````````````````````````` + + +This is not a link reference definition, because it is indented +four spaces: + +```````````````````````````````` example + [foo]: /url "title" + +[foo] +. +
[foo]: /url "title"
+
+

[foo]

+```````````````````````````````` + + +This is not a link reference definition, because it occurs inside +a code block: + +```````````````````````````````` example +``` +[foo]: /url +``` + +[foo] +. +
[foo]: /url
+
+

[foo]

+```````````````````````````````` + + +A [link reference definition] cannot interrupt a paragraph. + +```````````````````````````````` example +Foo +[bar]: /baz + +[bar] +. +

Foo +[bar]: /baz

+

[bar]

+```````````````````````````````` + + +However, it can directly follow other block elements, such as headings +and thematic breaks, and it need not be followed by a blank line. + +```````````````````````````````` example +# [Foo] +[foo]: /url +> bar +. +

Foo

+
+

bar

+
+```````````````````````````````` + +```````````````````````````````` example +[foo]: /url +bar +=== +[foo] +. +

bar

+

foo

+```````````````````````````````` + +```````````````````````````````` example +[foo]: /url +=== +[foo] +. +

=== +foo

+```````````````````````````````` + + +Several [link reference definitions] +can occur one after another, without intervening blank lines. + +```````````````````````````````` example +[foo]: /foo-url "foo" +[bar]: /bar-url + "bar" +[baz]: /baz-url + +[foo], +[bar], +[baz] +. +

foo, +bar, +baz

+```````````````````````````````` + + +[Link reference definitions] can occur +inside block containers, like lists and block quotations. They +affect the entire document, not just the container in which they +are defined: + +```````````````````````````````` example +[foo] + +> [foo]: /url +. +

foo

+
+
+```````````````````````````````` + + +Whether something is a [link reference definition] is +independent of whether the link reference it defines is +used in the document. Thus, for example, the following +document contains just a link reference definition, and +no visible content: + +```````````````````````````````` example +[foo]: /url +. +```````````````````````````````` + + +## Paragraphs + +A sequence of non-blank lines that cannot be interpreted as other +kinds of blocks forms a [paragraph](@). +The contents of the paragraph are the result of parsing the +paragraph's raw content as inlines. The paragraph's raw content +is formed by concatenating the lines and removing initial and final +[whitespace]. + +A simple example with two paragraphs: + +```````````````````````````````` example +aaa + +bbb +. +

aaa

+

bbb

+```````````````````````````````` + + +Paragraphs can contain multiple lines, but no blank lines: + +```````````````````````````````` example +aaa +bbb + +ccc +ddd +. +

aaa +bbb

+

ccc +ddd

+```````````````````````````````` + + +Multiple blank lines between paragraph have no effect: + +```````````````````````````````` example +aaa + + +bbb +. +

aaa

+

bbb

+```````````````````````````````` + + +Leading spaces are skipped: + +```````````````````````````````` example + aaa + bbb +. +

aaa +bbb

+```````````````````````````````` + + +Lines after the first may be indented any amount, since indented +code blocks cannot interrupt paragraphs. + +```````````````````````````````` example +aaa + bbb + ccc +. +

aaa +bbb +ccc

+```````````````````````````````` + + +However, the first line may be indented at most three spaces, +or an indented code block will be triggered: + +```````````````````````````````` example + aaa +bbb +. +

aaa +bbb

+```````````````````````````````` + + +```````````````````````````````` example + aaa +bbb +. +
aaa
+
+

bbb

+```````````````````````````````` + + +Final spaces are stripped before inline parsing, so a paragraph +that ends with two or more spaces will not end with a [hard line +break]: + +```````````````````````````````` example +aaa +bbb +. +

aaa
+bbb

+```````````````````````````````` + + +## Blank lines + +[Blank lines] between block-level elements are ignored, +except for the role they play in determining whether a [list] +is [tight] or [loose]. + +Blank lines at the beginning and end of the document are also ignored. + +```````````````````````````````` example + + +aaa + + +# aaa + + +. +

aaa

+

aaa

+```````````````````````````````` + + + +# Container blocks + +A [container block](#container-blocks) is a block that has other +blocks as its contents. There are two basic kinds of container blocks: +[block quotes] and [list items]. +[Lists] are meta-containers for [list items]. + +We define the syntax for container blocks recursively. The general +form of the definition is: + +> If X is a sequence of blocks, then the result of +> transforming X in such-and-such a way is a container of type Y +> with these blocks as its content. + +So, we explain what counts as a block quote or list item by explaining +how these can be *generated* from their contents. This should suffice +to define the syntax, although it does not give a recipe for *parsing* +these constructions. (A recipe is provided below in the section entitled +[A parsing strategy](#appendix-a-parsing-strategy).) + +## Block quotes + +A [block quote marker](@) +consists of 0-3 spaces of initial indent, plus (a) the character `>` together +with a following space, or (b) a single character `>` not followed by a space. + +The following rules define [block quotes]: + +1. **Basic case.** If a string of lines *Ls* constitute a sequence + of blocks *Bs*, then the result of prepending a [block quote + marker] to the beginning of each line in *Ls* + is a [block quote](#block-quotes) containing *Bs*. + +2. **Laziness.** If a string of lines *Ls* constitute a [block + quote](#block-quotes) with contents *Bs*, then the result of deleting + the initial [block quote marker] from one or + more lines in which the next [non-whitespace character] after the [block + quote marker] is [paragraph continuation + text] is a block quote with *Bs* as its content. + [Paragraph continuation text](@) is text + that will be parsed as part of the content of a paragraph, but does + not occur at the beginning of the paragraph. + +3. **Consecutiveness.** A document cannot contain two [block + quotes] in a row unless there is a [blank line] between them. + +Nothing else counts as a [block quote](#block-quotes). + +Here is a simple example: + +```````````````````````````````` example +> # Foo +> bar +> baz +. +
+

Foo

+

bar +baz

+
+```````````````````````````````` + + +The spaces after the `>` characters can be omitted: + +```````````````````````````````` example +># Foo +>bar +> baz +. +
+

Foo

+

bar +baz

+
+```````````````````````````````` + + +The `>` characters can be indented 1-3 spaces: + +```````````````````````````````` example + > # Foo + > bar + > baz +. +
+

Foo

+

bar +baz

+
+```````````````````````````````` + + +Four spaces gives us a code block: + +```````````````````````````````` example + > # Foo + > bar + > baz +. +
> # Foo
+> bar
+> baz
+
+```````````````````````````````` + + +The Laziness clause allows us to omit the `>` before +[paragraph continuation text]: + +```````````````````````````````` example +> # Foo +> bar +baz +. +
+

Foo

+

bar +baz

+
+```````````````````````````````` + + +A block quote can contain some lazy and some non-lazy +continuation lines: + +```````````````````````````````` example +> bar +baz +> foo +. +
+

bar +baz +foo

+
+```````````````````````````````` + + +Laziness only applies to lines that would have been continuations of +paragraphs had they been prepended with [block quote markers]. +For example, the `> ` cannot be omitted in the second line of + +``` markdown +> foo +> --- +``` + +without changing the meaning: + +```````````````````````````````` example +> foo +--- +. +
+

foo

+
+
+```````````````````````````````` + + +Similarly, if we omit the `> ` in the second line of + +``` markdown +> - foo +> - bar +``` + +then the block quote ends after the first line: + +```````````````````````````````` example +> - foo +- bar +. +
+
    +
  • foo
  • +
+
+
    +
  • bar
  • +
+```````````````````````````````` + + +For the same reason, we can't omit the `> ` in front of +subsequent lines of an indented or fenced code block: + +```````````````````````````````` example +> foo + bar +. +
+
foo
+
+
+
bar
+
+```````````````````````````````` + + +```````````````````````````````` example +> ``` +foo +``` +. +
+
+
+

foo

+
+```````````````````````````````` + + +Note that in the following case, we have a [lazy +continuation line]: + +```````````````````````````````` example +> foo + - bar +. +
+

foo +- bar

+
+```````````````````````````````` + + +To see why, note that in + +```markdown +> foo +> - bar +``` + +the `- bar` is indented too far to start a list, and can't +be an indented code block because indented code blocks cannot +interrupt paragraphs, so it is [paragraph continuation text]. + +A block quote can be empty: + +```````````````````````````````` example +> +. +
+
+```````````````````````````````` + + +```````````````````````````````` example +> +> +> +. +
+
+```````````````````````````````` + + +A block quote can have initial or final blank lines: + +```````````````````````````````` example +> +> foo +> +. +
+

foo

+
+```````````````````````````````` + + +A blank line always separates block quotes: + +```````````````````````````````` example +> foo + +> bar +. +
+

foo

+
+
+

bar

+
+```````````````````````````````` + + +(Most current Markdown implementations, including John Gruber's +original `Markdown.pl`, will parse this example as a single block quote +with two paragraphs. But it seems better to allow the author to decide +whether two block quotes or one are wanted.) + +Consecutiveness means that if we put these block quotes together, +we get a single block quote: + +```````````````````````````````` example +> foo +> bar +. +
+

foo +bar

+
+```````````````````````````````` + + +To get a block quote with two paragraphs, use: + +```````````````````````````````` example +> foo +> +> bar +. +
+

foo

+

bar

+
+```````````````````````````````` + + +Block quotes can interrupt paragraphs: + +```````````````````````````````` example +foo +> bar +. +

foo

+
+

bar

+
+```````````````````````````````` + + +In general, blank lines are not needed before or after block +quotes: + +```````````````````````````````` example +> aaa +*** +> bbb +. +
+

aaa

+
+
+
+

bbb

+
+```````````````````````````````` + + +However, because of laziness, a blank line is needed between +a block quote and a following paragraph: + +```````````````````````````````` example +> bar +baz +. +
+

bar +baz

+
+```````````````````````````````` + + +```````````````````````````````` example +> bar + +baz +. +
+

bar

+
+

baz

+```````````````````````````````` + + +```````````````````````````````` example +> bar +> +baz +. +
+

bar

+
+

baz

+```````````````````````````````` + + +It is a consequence of the Laziness rule that any number +of initial `>`s may be omitted on a continuation line of a +nested block quote: + +```````````````````````````````` example +> > > foo +bar +. +
+
+
+

foo +bar

+
+
+
+```````````````````````````````` + + +```````````````````````````````` example +>>> foo +> bar +>>baz +. +
+
+
+

foo +bar +baz

+
+
+
+```````````````````````````````` + + +When including an indented code block in a block quote, +remember that the [block quote marker] includes +both the `>` and a following space. So *five spaces* are needed after +the `>`: + +```````````````````````````````` example +> code + +> not code +. +
+
code
+
+
+
+

not code

+
+```````````````````````````````` + + + +## List items + +A [list marker](@) is a +[bullet list marker] or an [ordered list marker]. + +A [bullet list marker](@) +is a `-`, `+`, or `*` character. + +An [ordered list marker](@) +is a sequence of 1--9 arabic digits (`0-9`), followed by either a +`.` character or a `)` character. (The reason for the length +limit is that with 10 digits we start seeing integer overflows +in some browsers.) + +The following rules define [list items]: + +1. **Basic case.** If a sequence of lines *Ls* constitute a sequence of + blocks *Bs* starting with a [non-whitespace character], and *M* is a + list marker of width *W* followed by 1 ≤ *N* ≤ 4 spaces, then the result + of prepending *M* and the following spaces to the first line of + *Ls*, and indenting subsequent lines of *Ls* by *W + N* spaces, is a + list item with *Bs* as its contents. The type of the list item + (bullet or ordered) is determined by the type of its list marker. + If the list item is ordered, then it is also assigned a start + number, based on the ordered list marker. + + Exceptions: + + 1. When the first list item in a [list] interrupts + a paragraph---that is, when it starts on a line that would + otherwise count as [paragraph continuation text]---then (a) + the lines *Ls* must not begin with a blank line, and (b) if + the list item is ordered, the start number must be 1. + 2. If any line is a [thematic break][thematic breaks] then + that line is not a list item. + +For example, let *Ls* be the lines + +```````````````````````````````` example +A paragraph +with two lines. + + indented code + +> A block quote. +. +

A paragraph +with two lines.

+
indented code
+
+
+

A block quote.

+
+```````````````````````````````` + + +And let *M* be the marker `1.`, and *N* = 2. Then rule #1 says +that the following is an ordered list item with start number 1, +and the same contents as *Ls*: + +```````````````````````````````` example +1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +The most important thing to notice is that the position of +the text after the list marker determines how much indentation +is needed in subsequent blocks in the list item. If the list +marker takes up two spaces, and there are three spaces between +the list marker and the next [non-whitespace character], then blocks +must be indented five spaces in order to fall under the list +item. + +Here are some examples showing how far content must be indented to be +put under the list item: + +```````````````````````````````` example +- one + + two +. +
    +
  • one
  • +
+

two

+```````````````````````````````` + + +```````````````````````````````` example +- one + + two +. +
    +
  • +

    one

    +

    two

    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example + - one + + two +. +
    +
  • one
  • +
+
 two
+
+```````````````````````````````` + + +```````````````````````````````` example + - one + + two +. +
    +
  • +

    one

    +

    two

    +
  • +
+```````````````````````````````` + + +It is tempting to think of this in terms of columns: the continuation +blocks must be indented at least to the column of the first +[non-whitespace character] after the list marker. However, that is not quite right. +The spaces after the list marker determine how much relative indentation +is needed. Which column this indentation reaches will depend on +how the list item is embedded in other constructions, as shown by +this example: + +```````````````````````````````` example + > > 1. one +>> +>> two +. +
+
+
    +
  1. +

    one

    +

    two

    +
  2. +
+
+
+```````````````````````````````` + + +Here `two` occurs in the same column as the list marker `1.`, +but is actually contained in the list item, because there is +sufficient indentation after the last containing blockquote marker. + +The converse is also possible. In the following example, the word `two` +occurs far to the right of the initial text of the list item, `one`, but +it is not considered part of the list item, because it is not indented +far enough past the blockquote marker: + +```````````````````````````````` example +>>- one +>> + > > two +. +
+
+
    +
  • one
  • +
+

two

+
+
+```````````````````````````````` + + +Note that at least one space is needed between the list marker and +any following content, so these are not list items: + +```````````````````````````````` example +-one + +2.two +. +

-one

+

2.two

+```````````````````````````````` + + +A list item may contain blocks that are separated by more than +one blank line. + +```````````````````````````````` example +- foo + + + bar +. +
    +
  • +

    foo

    +

    bar

    +
  • +
+```````````````````````````````` + + +A list item may contain any kind of block: + +```````````````````````````````` example +1. foo + + ``` + bar + ``` + + baz + + > bam +. +
    +
  1. +

    foo

    +
    bar
    +
    +

    baz

    +
    +

    bam

    +
    +
  2. +
+```````````````````````````````` + + +A list item that contains an indented code block will preserve +empty lines within the code block verbatim. + +```````````````````````````````` example +- Foo + + bar + + + baz +. +
    +
  • +

    Foo

    +
    bar
    +
    +
    +baz
    +
    +
  • +
+```````````````````````````````` + +Note that ordered list start numbers must be nine digits or less: + +```````````````````````````````` example +123456789. ok +. +
    +
  1. ok
  2. +
+```````````````````````````````` + + +```````````````````````````````` example +1234567890. not ok +. +

1234567890. not ok

+```````````````````````````````` + + +A start number may begin with 0s: + +```````````````````````````````` example +0. ok +. +
    +
  1. ok
  2. +
+```````````````````````````````` + + +```````````````````````````````` example +003. ok +. +
    +
  1. ok
  2. +
+```````````````````````````````` + + +A start number may not be negative: + +```````````````````````````````` example +-1. not ok +. +

-1. not ok

+```````````````````````````````` + + + +2. **Item starting with indented code.** If a sequence of lines *Ls* + constitute a sequence of blocks *Bs* starting with an indented code + block, and *M* is a list marker of width *W* followed by + one space, then the result of prepending *M* and the following + space to the first line of *Ls*, and indenting subsequent lines of + *Ls* by *W + 1* spaces, is a list item with *Bs* as its contents. + If a line is empty, then it need not be indented. The type of the + list item (bullet or ordered) is determined by the type of its list + marker. If the list item is ordered, then it is also assigned a + start number, based on the ordered list marker. + +An indented code block will have to be indented four spaces beyond +the edge of the region where text will be included in the list item. +In the following case that is 6 spaces: + +```````````````````````````````` example +- foo + + bar +. +
    +
  • +

    foo

    +
    bar
    +
    +
  • +
+```````````````````````````````` + + +And in this case it is 11 spaces: + +```````````````````````````````` example + 10. foo + + bar +. +
    +
  1. +

    foo

    +
    bar
    +
    +
  2. +
+```````````````````````````````` + + +If the *first* block in the list item is an indented code block, +then by rule #2, the contents must be indented *one* space after the +list marker: + +```````````````````````````````` example + indented code + +paragraph + + more code +. +
indented code
+
+

paragraph

+
more code
+
+```````````````````````````````` + + +```````````````````````````````` example +1. indented code + + paragraph + + more code +. +
    +
  1. +
    indented code
    +
    +

    paragraph

    +
    more code
    +
    +
  2. +
+```````````````````````````````` + + +Note that an additional space indent is interpreted as space +inside the code block: + +```````````````````````````````` example +1. indented code + + paragraph + + more code +. +
    +
  1. +
     indented code
    +
    +

    paragraph

    +
    more code
    +
    +
  2. +
+```````````````````````````````` + + +Note that rules #1 and #2 only apply to two cases: (a) cases +in which the lines to be included in a list item begin with a +[non-whitespace character], and (b) cases in which +they begin with an indented code +block. In a case like the following, where the first block begins with +a three-space indent, the rules do not allow us to form a list item by +indenting the whole thing and prepending a list marker: + +```````````````````````````````` example + foo + +bar +. +

foo

+

bar

+```````````````````````````````` + + +```````````````````````````````` example +- foo + + bar +. +
    +
  • foo
  • +
+

bar

+```````````````````````````````` + + +This is not a significant restriction, because when a block begins +with 1-3 spaces indent, the indentation can always be removed without +a change in interpretation, allowing rule #1 to be applied. So, in +the above case: + +```````````````````````````````` example +- foo + + bar +. +
    +
  • +

    foo

    +

    bar

    +
  • +
+```````````````````````````````` + + +3. **Item starting with a blank line.** If a sequence of lines *Ls* + starting with a single [blank line] constitute a (possibly empty) + sequence of blocks *Bs*, not separated from each other by more than + one blank line, and *M* is a list marker of width *W*, + then the result of prepending *M* to the first line of *Ls*, and + indenting subsequent lines of *Ls* by *W + 1* spaces, is a list + item with *Bs* as its contents. + If a line is empty, then it need not be indented. The type of the + list item (bullet or ordered) is determined by the type of its list + marker. If the list item is ordered, then it is also assigned a + start number, based on the ordered list marker. + +Here are some list items that start with a blank line but are not empty: + +```````````````````````````````` example +- + foo +- + ``` + bar + ``` +- + baz +. +
    +
  • foo
  • +
  • +
    bar
    +
    +
  • +
  • +
    baz
    +
    +
  • +
+```````````````````````````````` + +When the list item starts with a blank line, the number of spaces +following the list marker doesn't change the required indentation: + +```````````````````````````````` example +- + foo +. +
    +
  • foo
  • +
+```````````````````````````````` + + +A list item can begin with at most one blank line. +In the following example, `foo` is not part of the list +item: + +```````````````````````````````` example +- + + foo +. +
    +
  • +
+

foo

+```````````````````````````````` + + +Here is an empty bullet list item: + +```````````````````````````````` example +- foo +- +- bar +. +
    +
  • foo
  • +
  • +
  • bar
  • +
+```````````````````````````````` + + +It does not matter whether there are spaces following the [list marker]: + +```````````````````````````````` example +- foo +- +- bar +. +
    +
  • foo
  • +
  • +
  • bar
  • +
+```````````````````````````````` + + +Here is an empty ordered list item: + +```````````````````````````````` example +1. foo +2. +3. bar +. +
    +
  1. foo
  2. +
  3. +
  4. bar
  5. +
+```````````````````````````````` + + +A list may start or end with an empty list item: + +```````````````````````````````` example +* +. +
    +
  • +
+```````````````````````````````` + +However, an empty list item cannot interrupt a paragraph: + +```````````````````````````````` example +foo +* + +foo +1. +. +

foo +*

+

foo +1.

+```````````````````````````````` + + +4. **Indentation.** If a sequence of lines *Ls* constitutes a list item + according to rule #1, #2, or #3, then the result of indenting each line + of *Ls* by 1-3 spaces (the same for each line) also constitutes a + list item with the same contents and attributes. If a line is + empty, then it need not be indented. + +Indented one space: + +```````````````````````````````` example + 1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +Indented two spaces: + +```````````````````````````````` example + 1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +Indented three spaces: + +```````````````````````````````` example + 1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +Four spaces indent gives a code block: + +```````````````````````````````` example + 1. A paragraph + with two lines. + + indented code + + > A block quote. +. +
1.  A paragraph
+    with two lines.
+
+        indented code
+
+    > A block quote.
+
+```````````````````````````````` + + + +5. **Laziness.** If a string of lines *Ls* constitute a [list + item](#list-items) with contents *Bs*, then the result of deleting + some or all of the indentation from one or more lines in which the + next [non-whitespace character] after the indentation is + [paragraph continuation text] is a + list item with the same contents and attributes. The unindented + lines are called + [lazy continuation line](@)s. + +Here is an example with [lazy continuation lines]: + +```````````````````````````````` example + 1. A paragraph +with two lines. + + indented code + + > A block quote. +. +
    +
  1. +

    A paragraph +with two lines.

    +
    indented code
    +
    +
    +

    A block quote.

    +
    +
  2. +
+```````````````````````````````` + + +Indentation can be partially deleted: + +```````````````````````````````` example + 1. A paragraph + with two lines. +. +
    +
  1. A paragraph +with two lines.
  2. +
+```````````````````````````````` + + +These examples show how laziness can work in nested structures: + +```````````````````````````````` example +> 1. > Blockquote +continued here. +. +
+
    +
  1. +
    +

    Blockquote +continued here.

    +
    +
  2. +
+
+```````````````````````````````` + + +```````````````````````````````` example +> 1. > Blockquote +> continued here. +. +
+
    +
  1. +
    +

    Blockquote +continued here.

    +
    +
  2. +
+
+```````````````````````````````` + + + +6. **That's all.** Nothing that is not counted as a list item by rules + #1--5 counts as a [list item](#list-items). + +The rules for sublists follow from the general rules +[above][List items]. A sublist must be indented the same number +of spaces a paragraph would need to be in order to be included +in the list item. + +So, in this case we need two spaces indent: + +```````````````````````````````` example +- foo + - bar + - baz + - boo +. +
    +
  • foo +
      +
    • bar +
        +
      • baz +
          +
        • boo
        • +
        +
      • +
      +
    • +
    +
  • +
+```````````````````````````````` + + +One is not enough: + +```````````````````````````````` example +- foo + - bar + - baz + - boo +. +
    +
  • foo
  • +
  • bar
  • +
  • baz
  • +
  • boo
  • +
+```````````````````````````````` + + +Here we need four, because the list marker is wider: + +```````````````````````````````` example +10) foo + - bar +. +
    +
  1. foo +
      +
    • bar
    • +
    +
  2. +
+```````````````````````````````` + + +Three is not enough: + +```````````````````````````````` example +10) foo + - bar +. +
    +
  1. foo
  2. +
+
    +
  • bar
  • +
+```````````````````````````````` + + +A list may be the first block in a list item: + +```````````````````````````````` example +- - foo +. +
    +
  • +
      +
    • foo
    • +
    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example +1. - 2. foo +. +
    +
  1. +
      +
    • +
        +
      1. foo
      2. +
      +
    • +
    +
  2. +
+```````````````````````````````` + + +A list item can contain a heading: + +```````````````````````````````` example +- # Foo +- Bar + --- + baz +. +
    +
  • +

    Foo

    +
  • +
  • +

    Bar

    +baz
  • +
+```````````````````````````````` + + +### Motivation + +John Gruber's Markdown spec says the following about list items: + +1. "List markers typically start at the left margin, but may be indented + by up to three spaces. List markers must be followed by one or more + spaces or a tab." + +2. "To make lists look nice, you can wrap items with hanging indents.... + But if you don't want to, you don't have to." + +3. "List items may consist of multiple paragraphs. Each subsequent + paragraph in a list item must be indented by either 4 spaces or one + tab." + +4. "It looks nice if you indent every line of the subsequent paragraphs, + but here again, Markdown will allow you to be lazy." + +5. "To put a blockquote within a list item, the blockquote's `>` + delimiters need to be indented." + +6. "To put a code block within a list item, the code block needs to be + indented twice — 8 spaces or two tabs." + +These rules specify that a paragraph under a list item must be indented +four spaces (presumably, from the left margin, rather than the start of +the list marker, but this is not said), and that code under a list item +must be indented eight spaces instead of the usual four. They also say +that a block quote must be indented, but not by how much; however, the +example given has four spaces indentation. Although nothing is said +about other kinds of block-level content, it is certainly reasonable to +infer that *all* block elements under a list item, including other +lists, must be indented four spaces. This principle has been called the +*four-space rule*. + +The four-space rule is clear and principled, and if the reference +implementation `Markdown.pl` had followed it, it probably would have +become the standard. However, `Markdown.pl` allowed paragraphs and +sublists to start with only two spaces indentation, at least on the +outer level. Worse, its behavior was inconsistent: a sublist of an +outer-level list needed two spaces indentation, but a sublist of this +sublist needed three spaces. It is not surprising, then, that different +implementations of Markdown have developed very different rules for +determining what comes under a list item. (Pandoc and python-Markdown, +for example, stuck with Gruber's syntax description and the four-space +rule, while discount, redcarpet, marked, PHP Markdown, and others +followed `Markdown.pl`'s behavior more closely.) + +Unfortunately, given the divergences between implementations, there +is no way to give a spec for list items that will be guaranteed not +to break any existing documents. However, the spec given here should +correctly handle lists formatted with either the four-space rule or +the more forgiving `Markdown.pl` behavior, provided they are laid out +in a way that is natural for a human to read. + +The strategy here is to let the width and indentation of the list marker +determine the indentation necessary for blocks to fall under the list +item, rather than having a fixed and arbitrary number. The writer can +think of the body of the list item as a unit which gets indented to the +right enough to fit the list marker (and any indentation on the list +marker). (The laziness rule, #5, then allows continuation lines to be +unindented if needed.) + +This rule is superior, we claim, to any rule requiring a fixed level of +indentation from the margin. The four-space rule is clear but +unnatural. It is quite unintuitive that + +``` markdown +- foo + + bar + + - baz +``` + +should be parsed as two lists with an intervening paragraph, + +``` html +
    +
  • foo
  • +
+

bar

+
    +
  • baz
  • +
+``` + +as the four-space rule demands, rather than a single list, + +``` html +
    +
  • +

    foo

    +

    bar

    +
      +
    • baz
    • +
    +
  • +
+``` + +The choice of four spaces is arbitrary. It can be learned, but it is +not likely to be guessed, and it trips up beginners regularly. + +Would it help to adopt a two-space rule? The problem is that such +a rule, together with the rule allowing 1--3 spaces indentation of the +initial list marker, allows text that is indented *less than* the +original list marker to be included in the list item. For example, +`Markdown.pl` parses + +``` markdown + - one + + two +``` + +as a single list item, with `two` a continuation paragraph: + +``` html +
    +
  • +

    one

    +

    two

    +
  • +
+``` + +and similarly + +``` markdown +> - one +> +> two +``` + +as + +``` html +
+
    +
  • +

    one

    +

    two

    +
  • +
+
+``` + +This is extremely unintuitive. + +Rather than requiring a fixed indent from the margin, we could require +a fixed indent (say, two spaces, or even one space) from the list marker (which +may itself be indented). This proposal would remove the last anomaly +discussed. Unlike the spec presented above, it would count the following +as a list item with a subparagraph, even though the paragraph `bar` +is not indented as far as the first paragraph `foo`: + +``` markdown + 10. foo + + bar +``` + +Arguably this text does read like a list item with `bar` as a subparagraph, +which may count in favor of the proposal. However, on this proposal indented +code would have to be indented six spaces after the list marker. And this +would break a lot of existing Markdown, which has the pattern: + +``` markdown +1. foo + + indented code +``` + +where the code is indented eight spaces. The spec above, by contrast, will +parse this text as expected, since the code block's indentation is measured +from the beginning of `foo`. + +The one case that needs special treatment is a list item that *starts* +with indented code. How much indentation is required in that case, since +we don't have a "first paragraph" to measure from? Rule #2 simply stipulates +that in such cases, we require one space indentation from the list marker +(and then the normal four spaces for the indented code). This will match the +four-space rule in cases where the list marker plus its initial indentation +takes four spaces (a common case), but diverge in other cases. + +## Lists + +A [list](@) is a sequence of one or more +list items [of the same type]. The list items +may be separated by any number of blank lines. + +Two list items are [of the same type](@) +if they begin with a [list marker] of the same type. +Two list markers are of the +same type if (a) they are bullet list markers using the same character +(`-`, `+`, or `*`) or (b) they are ordered list numbers with the same +delimiter (either `.` or `)`). + +A list is an [ordered list](@) +if its constituent list items begin with +[ordered list markers], and a +[bullet list](@) if its constituent list +items begin with [bullet list markers]. + +The [start number](@) +of an [ordered list] is determined by the list number of +its initial list item. The numbers of subsequent list items are +disregarded. + +A list is [loose](@) if any of its constituent +list items are separated by blank lines, or if any of its constituent +list items directly contain two block-level elements with a blank line +between them. Otherwise a list is [tight](@). +(The difference in HTML output is that paragraphs in a loose list are +wrapped in `

` tags, while paragraphs in a tight list are not.) + +Changing the bullet or ordered list delimiter starts a new list: + +```````````````````````````````` example +- foo +- bar ++ baz +. +

    +
  • foo
  • +
  • bar
  • +
+
    +
  • baz
  • +
+```````````````````````````````` + + +```````````````````````````````` example +1. foo +2. bar +3) baz +. +
    +
  1. foo
  2. +
  3. bar
  4. +
+
    +
  1. baz
  2. +
+```````````````````````````````` + + +In CommonMark, a list can interrupt a paragraph. That is, +no blank line is needed to separate a paragraph from a following +list: + +```````````````````````````````` example +Foo +- bar +- baz +. +

Foo

+
    +
  • bar
  • +
  • baz
  • +
+```````````````````````````````` + +`Markdown.pl` does not allow this, through fear of triggering a list +via a numeral in a hard-wrapped line: + +``` markdown +The number of windows in my house is +14. The number of doors is 6. +``` + +Oddly, though, `Markdown.pl` *does* allow a blockquote to +interrupt a paragraph, even though the same considerations might +apply. + +In CommonMark, we do allow lists to interrupt paragraphs, for +two reasons. First, it is natural and not uncommon for people +to start lists without blank lines: + +``` markdown +I need to buy +- new shoes +- a coat +- a plane ticket +``` + +Second, we are attracted to a + +> [principle of uniformity](@): +> if a chunk of text has a certain +> meaning, it will continue to have the same meaning when put into a +> container block (such as a list item or blockquote). + +(Indeed, the spec for [list items] and [block quotes] presupposes +this principle.) This principle implies that if + +``` markdown + * I need to buy + - new shoes + - a coat + - a plane ticket +``` + +is a list item containing a paragraph followed by a nested sublist, +as all Markdown implementations agree it is (though the paragraph +may be rendered without `

` tags, since the list is "tight"), +then + +``` markdown +I need to buy +- new shoes +- a coat +- a plane ticket +``` + +by itself should be a paragraph followed by a nested sublist. + +Since it is well established Markdown practice to allow lists to +interrupt paragraphs inside list items, the [principle of +uniformity] requires us to allow this outside list items as +well. ([reStructuredText](http://docutils.sourceforge.net/rst.html) +takes a different approach, requiring blank lines before lists +even inside other list items.) + +In order to solve of unwanted lists in paragraphs with +hard-wrapped numerals, we allow only lists starting with `1` to +interrupt paragraphs. Thus, + +```````````````````````````````` example +The number of windows in my house is +14. The number of doors is 6. +. +

The number of windows in my house is +14. The number of doors is 6.

+```````````````````````````````` + +We may still get an unintended result in cases like + +```````````````````````````````` example +The number of windows in my house is +1. The number of doors is 6. +. +

The number of windows in my house is

+
    +
  1. The number of doors is 6.
  2. +
+```````````````````````````````` + +but this rule should prevent most spurious list captures. + +There can be any number of blank lines between items: + +```````````````````````````````` example +- foo + +- bar + + +- baz +. +
    +
  • +

    foo

    +
  • +
  • +

    bar

    +
  • +
  • +

    baz

    +
  • +
+```````````````````````````````` + +```````````````````````````````` example +- foo + - bar + - baz + + + bim +. +
    +
  • foo +
      +
    • bar +
        +
      • +

        baz

        +

        bim

        +
      • +
      +
    • +
    +
  • +
+```````````````````````````````` + + +To separate consecutive lists of the same type, or to separate a +list from an indented code block that would otherwise be parsed +as a subparagraph of the final list item, you can insert a blank HTML +comment: + +```````````````````````````````` example +- foo +- bar + + + +- baz +- bim +. +
    +
  • foo
  • +
  • bar
  • +
+ +
    +
  • baz
  • +
  • bim
  • +
+```````````````````````````````` + + +```````````````````````````````` example +- foo + + notcode + +- foo + + + + code +. +
    +
  • +

    foo

    +

    notcode

    +
  • +
  • +

    foo

    +
  • +
+ +
code
+
+```````````````````````````````` + + +List items need not be indented to the same level. The following +list items will be treated as items at the same list level, +since none is indented enough to belong to the previous list +item: + +```````````````````````````````` example +- a + - b + - c + - d + - e + - f +- g +. +
    +
  • a
  • +
  • b
  • +
  • c
  • +
  • d
  • +
  • e
  • +
  • f
  • +
  • g
  • +
+```````````````````````````````` + + +```````````````````````````````` example +1. a + + 2. b + + 3. c +. +
    +
  1. +

    a

    +
  2. +
  3. +

    b

    +
  4. +
  5. +

    c

    +
  6. +
+```````````````````````````````` + +Note, however, that list items may not be indented more than +three spaces. Here `- e` is treated as a paragraph continuation +line, because it is indented more than three spaces: + +```````````````````````````````` example +- a + - b + - c + - d + - e +. +
    +
  • a
  • +
  • b
  • +
  • c
  • +
  • d +- e
  • +
+```````````````````````````````` + +And here, `3. c` is treated as in indented code block, +because it is indented four spaces and preceded by a +blank line. + +```````````````````````````````` example +1. a + + 2. b + + 3. c +. +
    +
  1. +

    a

    +
  2. +
  3. +

    b

    +
  4. +
+
3. c
+
+```````````````````````````````` + + +This is a loose list, because there is a blank line between +two of the list items: + +```````````````````````````````` example +- a +- b + +- c +. +
    +
  • +

    a

    +
  • +
  • +

    b

    +
  • +
  • +

    c

    +
  • +
+```````````````````````````````` + + +So is this, with a empty second item: + +```````````````````````````````` example +* a +* + +* c +. +
    +
  • +

    a

    +
  • +
  • +
  • +

    c

    +
  • +
+```````````````````````````````` + + +These are loose lists, even though there is no space between the items, +because one of the items directly contains two block-level elements +with a blank line between them: + +```````````````````````````````` example +- a +- b + + c +- d +. +
    +
  • +

    a

    +
  • +
  • +

    b

    +

    c

    +
  • +
  • +

    d

    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example +- a +- b + + [ref]: /url +- d +. +
    +
  • +

    a

    +
  • +
  • +

    b

    +
  • +
  • +

    d

    +
  • +
+```````````````````````````````` + + +This is a tight list, because the blank lines are in a code block: + +```````````````````````````````` example +- a +- ``` + b + + + ``` +- c +. +
    +
  • a
  • +
  • +
    b
    +
    +
    +
    +
  • +
  • c
  • +
+```````````````````````````````` + + +This is a tight list, because the blank line is between two +paragraphs of a sublist. So the sublist is loose while +the outer list is tight: + +```````````````````````````````` example +- a + - b + + c +- d +. +
    +
  • a +
      +
    • +

      b

      +

      c

      +
    • +
    +
  • +
  • d
  • +
+```````````````````````````````` + + +This is a tight list, because the blank line is inside the +block quote: + +```````````````````````````````` example +* a + > b + > +* c +. +
    +
  • a +
    +

    b

    +
    +
  • +
  • c
  • +
+```````````````````````````````` + + +This list is tight, because the consecutive block elements +are not separated by blank lines: + +```````````````````````````````` example +- a + > b + ``` + c + ``` +- d +. +
    +
  • a +
    +

    b

    +
    +
    c
    +
    +
  • +
  • d
  • +
+```````````````````````````````` + + +A single-paragraph list is tight: + +```````````````````````````````` example +- a +. +
    +
  • a
  • +
+```````````````````````````````` + + +```````````````````````````````` example +- a + - b +. +
    +
  • a +
      +
    • b
    • +
    +
  • +
+```````````````````````````````` + + +This list is loose, because of the blank line between the +two block elements in the list item: + +```````````````````````````````` example +1. ``` + foo + ``` + + bar +. +
    +
  1. +
    foo
    +
    +

    bar

    +
  2. +
+```````````````````````````````` + + +Here the outer list is loose, the inner list tight: + +```````````````````````````````` example +* foo + * bar + + baz +. +
    +
  • +

    foo

    +
      +
    • bar
    • +
    +

    baz

    +
  • +
+```````````````````````````````` + + +```````````````````````````````` example +- a + - b + - c + +- d + - e + - f +. +
    +
  • +

    a

    +
      +
    • b
    • +
    • c
    • +
    +
  • +
  • +

    d

    +
      +
    • e
    • +
    • f
    • +
    +
  • +
+```````````````````````````````` + + +# Inlines + +Inlines are parsed sequentially from the beginning of the character +stream to the end (left to right, in left-to-right languages). +Thus, for example, in + +```````````````````````````````` example +`hi`lo` +. +

hilo`

+```````````````````````````````` + +`hi` is parsed as code, leaving the backtick at the end as a literal +backtick. + + +## Backslash escapes + +Any ASCII punctuation character may be backslash-escaped: + +```````````````````````````````` example +\!\"\#\$\%\&\'\(\)\*\+\,\-\.\/\:\;\<\=\>\?\@\[\\\]\^\_\`\{\|\}\~ +. +

!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~

+```````````````````````````````` + + +Backslashes before other characters are treated as literal +backslashes: + +```````````````````````````````` example +\→\A\a\ \3\φ\« +. +

\→\A\a\ \3\φ\«

+```````````````````````````````` + + +Escaped characters are treated as regular characters and do +not have their usual Markdown meanings: + +```````````````````````````````` example +\*not emphasized* +\
not a tag +\[not a link](/foo) +\`not code` +1\. not a list +\* not a list +\# not a heading +\[foo]: /url "not a reference" +\ö not a character entity +. +

*not emphasized* +<br/> not a tag +[not a link](/foo) +`not code` +1. not a list +* not a list +# not a heading +[foo]: /url "not a reference" +&ouml; not a character entity

+```````````````````````````````` + + +If a backslash is itself escaped, the following character is not: + +```````````````````````````````` example +\\*emphasis* +. +

\emphasis

+```````````````````````````````` + + +A backslash at the end of the line is a [hard line break]: + +```````````````````````````````` example +foo\ +bar +. +

foo
+bar

+```````````````````````````````` + + +Backslash escapes do not work in code blocks, code spans, autolinks, or +raw HTML: + +```````````````````````````````` example +`` \[\` `` +. +

\[\`

+```````````````````````````````` + + +```````````````````````````````` example + \[\] +. +
\[\]
+
+```````````````````````````````` + + +```````````````````````````````` example +~~~ +\[\] +~~~ +. +
\[\]
+
+```````````````````````````````` + + +```````````````````````````````` example + +. +

http://example.com?find=\*

+```````````````````````````````` + + +```````````````````````````````` example + +. + +```````````````````````````````` + + +But they work in all other contexts, including URLs and link titles, +link references, and [info strings] in [fenced code blocks]: + +```````````````````````````````` example +[foo](/bar\* "ti\*tle") +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[foo] + +[foo]: /bar\* "ti\*tle" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +``` foo\+bar +foo +``` +. +
foo
+
+```````````````````````````````` + + + +## Entity and numeric character references + +Valid HTML entity references and numeric character references +can be used in place of the corresponding Unicode character, +with the following exceptions: + +- Entity and character references are not recognized in code + blocks and code spans. + +- Entity and character references cannot stand in place of + special characters that define structural elements in + CommonMark. For example, although `*` can be used + in place of a literal `*` character, `*` cannot replace + `*` in emphasis delimiters, bullet list markers, or thematic + breaks. + +Conforming CommonMark parsers need not store information about +whether a particular character was represented in the source +using a Unicode character or an entity reference. + +[Entity references](@) consist of `&` + any of the valid +HTML5 entity names + `;`. The +document +is used as an authoritative source for the valid entity +references and their corresponding code points. + +```````````````````````````````` example +  & © Æ Ď +¾ ℋ ⅆ +∲ ≧̸ +. +

  & © Æ Ď +¾ ℋ ⅆ +∲ ≧̸

+```````````````````````````````` + + +[Decimal numeric character +references](@) +consist of `&#` + a string of 1--7 arabic digits + `;`. A +numeric character reference is parsed as the corresponding +Unicode character. Invalid Unicode code points will be replaced by +the REPLACEMENT CHARACTER (`U+FFFD`). For security reasons, +the code point `U+0000` will also be replaced by `U+FFFD`. + +```````````````````````````````` example +# Ӓ Ϡ � +. +

# Ӓ Ϡ �

+```````````````````````````````` + + +[Hexadecimal numeric character +references](@) consist of `&#` + +either `X` or `x` + a string of 1-6 hexadecimal digits + `;`. +They too are parsed as the corresponding Unicode character (this +time specified with a hexadecimal numeral instead of decimal). + +```````````````````````````````` example +" ആ ಫ +. +

" ആ ಫ

+```````````````````````````````` + + +Here are some nonentities: + +```````````````````````````````` example +  &x; &#; &#x; +� +&#abcdef0; +&ThisIsNotDefined; &hi?; +. +

&nbsp &x; &#; &#x; +&#87654321; +&#abcdef0; +&ThisIsNotDefined; &hi?;

+```````````````````````````````` + + +Although HTML5 does accept some entity references +without a trailing semicolon (such as `©`), these are not +recognized here, because it makes the grammar too ambiguous: + +```````````````````````````````` example +© +. +

&copy

+```````````````````````````````` + + +Strings that are not on the list of HTML5 named entities are not +recognized as entity references either: + +```````````````````````````````` example +&MadeUpEntity; +. +

&MadeUpEntity;

+```````````````````````````````` + + +Entity and numeric character references are recognized in any +context besides code spans or code blocks, including +URLs, [link titles], and [fenced code block][] [info strings]: + +```````````````````````````````` example + +. + +```````````````````````````````` + + +```````````````````````````````` example +[foo](/föö "föö") +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[foo] + +[foo]: /föö "föö" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +``` föö +foo +``` +. +
foo
+
+```````````````````````````````` + + +Entity and numeric character references are treated as literal +text in code spans and code blocks: + +```````````````````````````````` example +`föö` +. +

f&ouml;&ouml;

+```````````````````````````````` + + +```````````````````````````````` example + föfö +. +
f&ouml;f&ouml;
+
+```````````````````````````````` + + +Entity and numeric character references cannot be used +in place of symbols indicating structure in CommonMark +documents. + +```````````````````````````````` example +*foo* +*foo* +. +

*foo* +foo

+```````````````````````````````` + +```````````````````````````````` example +* foo + +* foo +. +

* foo

+
    +
  • foo
  • +
+```````````````````````````````` + +```````````````````````````````` example +foo bar +. +

foo + +bar

+```````````````````````````````` + +```````````````````````````````` example + foo +. +

→foo

+```````````````````````````````` + + +```````````````````````````````` example +[a](url "tit") +. +

[a](url "tit")

+```````````````````````````````` + + +## Code spans + +A [backtick string](@) +is a string of one or more backtick characters (`` ` ``) that is neither +preceded nor followed by a backtick. + +A [code span](@) begins with a backtick string and ends with +a backtick string of equal length. The contents of the code span are +the characters between the two backtick strings, normalized in the +following ways: + +- First, [line endings] are converted to [spaces]. +- If the resulting string both begins *and* ends with a [space] + character, but does not consist entirely of [space] + characters, a single [space] character is removed from the + front and back. This allows you to include code that begins + or ends with backtick characters, which must be separated by + whitespace from the opening or closing backtick strings. + +This is a simple code span: + +```````````````````````````````` example +`foo` +. +

foo

+```````````````````````````````` + + +Here two backticks are used, because the code contains a backtick. +This example also illustrates stripping of a single leading and +trailing space: + +```````````````````````````````` example +`` foo ` bar `` +. +

foo ` bar

+```````````````````````````````` + + +This example shows the motivation for stripping leading and trailing +spaces: + +```````````````````````````````` example +` `` ` +. +

``

+```````````````````````````````` + +Note that only *one* space is stripped: + +```````````````````````````````` example +` `` ` +. +

``

+```````````````````````````````` + +The stripping only happens if the space is on both +sides of the string: + +```````````````````````````````` example +` a` +. +

a

+```````````````````````````````` + +Only [spaces], and not [unicode whitespace] in general, are +stripped in this way: + +```````````````````````````````` example +` b ` +. +

 b 

+```````````````````````````````` + +No stripping occurs if the code span contains only spaces: + +```````````````````````````````` example +` ` +` ` +. +

  +

+```````````````````````````````` + + +[Line endings] are treated like spaces: + +```````````````````````````````` example +`` +foo +bar +baz +`` +. +

foo bar baz

+```````````````````````````````` + +```````````````````````````````` example +`` +foo +`` +. +

foo

+```````````````````````````````` + + +Interior spaces are not collapsed: + +```````````````````````````````` example +`foo bar +baz` +. +

foo bar baz

+```````````````````````````````` + +Note that browsers will typically collapse consecutive spaces +when rendering `` elements, so it is recommended that +the following CSS be used: + + code{white-space: pre-wrap;} + + +Note that backslash escapes do not work in code spans. All backslashes +are treated literally: + +```````````````````````````````` example +`foo\`bar` +. +

foo\bar`

+```````````````````````````````` + + +Backslash escapes are never needed, because one can always choose a +string of *n* backtick characters as delimiters, where the code does +not contain any strings of exactly *n* backtick characters. + +```````````````````````````````` example +``foo`bar`` +. +

foo`bar

+```````````````````````````````` + +```````````````````````````````` example +` foo `` bar ` +. +

foo `` bar

+```````````````````````````````` + + +Code span backticks have higher precedence than any other inline +constructs except HTML tags and autolinks. Thus, for example, this is +not parsed as emphasized text, since the second `*` is part of a code +span: + +```````````````````````````````` example +*foo`*` +. +

*foo*

+```````````````````````````````` + + +And this is not parsed as a link: + +```````````````````````````````` example +[not a `link](/foo`) +. +

[not a link](/foo)

+```````````````````````````````` + + +Code spans, HTML tags, and autolinks have the same precedence. +Thus, this is code: + +```````````````````````````````` example +`` +. +

<a href="">`

+```````````````````````````````` + + +But this is an HTML tag: + +```````````````````````````````` example +
` +. +

`

+```````````````````````````````` + + +And this is code: + +```````````````````````````````` example +`` +. +

<http://foo.bar.baz>`

+```````````````````````````````` + + +But this is an autolink: + +```````````````````````````````` example +` +. +

http://foo.bar.`baz`

+```````````````````````````````` + + +When a backtick string is not closed by a matching backtick string, +we just have literal backticks: + +```````````````````````````````` example +```foo`` +. +

```foo``

+```````````````````````````````` + + +```````````````````````````````` example +`foo +. +

`foo

+```````````````````````````````` + +The following case also illustrates the need for opening and +closing backtick strings to be equal in length: + +```````````````````````````````` example +`foo``bar`` +. +

`foobar

+```````````````````````````````` + + +## Emphasis and strong emphasis + +John Gruber's original [Markdown syntax +description](http://daringfireball.net/projects/markdown/syntax#em) says: + +> Markdown treats asterisks (`*`) and underscores (`_`) as indicators of +> emphasis. Text wrapped with one `*` or `_` will be wrapped with an HTML +> `` tag; double `*`'s or `_`'s will be wrapped with an HTML `` +> tag. + +This is enough for most users, but these rules leave much undecided, +especially when it comes to nested emphasis. The original +`Markdown.pl` test suite makes it clear that triple `***` and +`___` delimiters can be used for strong emphasis, and most +implementations have also allowed the following patterns: + +``` markdown +***strong emph*** +***strong** in emph* +***emph* in strong** +**in strong *emph*** +*in emph **strong*** +``` + +The following patterns are less widely supported, but the intent +is clear and they are useful (especially in contexts like bibliography +entries): + +``` markdown +*emph *with emph* in it* +**strong **with strong** in it** +``` + +Many implementations have also restricted intraword emphasis to +the `*` forms, to avoid unwanted emphasis in words containing +internal underscores. (It is best practice to put these in code +spans, but users often do not.) + +``` markdown +internal emphasis: foo*bar*baz +no emphasis: foo_bar_baz +``` + +The rules given below capture all of these patterns, while allowing +for efficient parsing strategies that do not backtrack. + +First, some definitions. A [delimiter run](@) is either +a sequence of one or more `*` characters that is not preceded or +followed by a non-backslash-escaped `*` character, or a sequence +of one or more `_` characters that is not preceded or followed by +a non-backslash-escaped `_` character. + +A [left-flanking delimiter run](@) is +a [delimiter run] that is (1) not followed by [Unicode whitespace], +and either (2a) not followed by a [punctuation character], or +(2b) followed by a [punctuation character] and +preceded by [Unicode whitespace] or a [punctuation character]. +For purposes of this definition, the beginning and the end of +the line count as Unicode whitespace. + +A [right-flanking delimiter run](@) is +a [delimiter run] that is (1) not preceded by [Unicode whitespace], +and either (2a) not preceded by a [punctuation character], or +(2b) preceded by a [punctuation character] and +followed by [Unicode whitespace] or a [punctuation character]. +For purposes of this definition, the beginning and the end of +the line count as Unicode whitespace. + +Here are some examples of delimiter runs. + + - left-flanking but not right-flanking: + + ``` + ***abc + _abc + **"abc" + _"abc" + ``` + + - right-flanking but not left-flanking: + + ``` + abc*** + abc_ + "abc"** + "abc"_ + ``` + + - Both left and right-flanking: + + ``` + abc***def + "abc"_"def" + ``` + + - Neither left nor right-flanking: + + ``` + abc *** def + a _ b + ``` + +(The idea of distinguishing left-flanking and right-flanking +delimiter runs based on the character before and the character +after comes from Roopesh Chander's +[vfmd](http://www.vfmd.org/vfmd-spec/specification/#procedure-for-identifying-emphasis-tags). +vfmd uses the terminology "emphasis indicator string" instead of "delimiter +run," and its rules for distinguishing left- and right-flanking runs +are a bit more complex than the ones given here.) + +The following rules define emphasis and strong emphasis: + +1. A single `*` character [can open emphasis](@) + iff (if and only if) it is part of a [left-flanking delimiter run]. + +2. A single `_` character [can open emphasis] iff + it is part of a [left-flanking delimiter run] + and either (a) not part of a [right-flanking delimiter run] + or (b) part of a [right-flanking delimiter run] + preceded by punctuation. + +3. A single `*` character [can close emphasis](@) + iff it is part of a [right-flanking delimiter run]. + +4. A single `_` character [can close emphasis] iff + it is part of a [right-flanking delimiter run] + and either (a) not part of a [left-flanking delimiter run] + or (b) part of a [left-flanking delimiter run] + followed by punctuation. + +5. A double `**` [can open strong emphasis](@) + iff it is part of a [left-flanking delimiter run]. + +6. A double `__` [can open strong emphasis] iff + it is part of a [left-flanking delimiter run] + and either (a) not part of a [right-flanking delimiter run] + or (b) part of a [right-flanking delimiter run] + preceded by punctuation. + +7. A double `**` [can close strong emphasis](@) + iff it is part of a [right-flanking delimiter run]. + +8. A double `__` [can close strong emphasis] iff + it is part of a [right-flanking delimiter run] + and either (a) not part of a [left-flanking delimiter run] + or (b) part of a [left-flanking delimiter run] + followed by punctuation. + +9. Emphasis begins with a delimiter that [can open emphasis] and ends + with a delimiter that [can close emphasis], and that uses the same + character (`_` or `*`) as the opening delimiter. The + opening and closing delimiters must belong to separate + [delimiter runs]. If one of the delimiters can both + open and close emphasis, then the sum of the lengths of the + delimiter runs containing the opening and closing delimiters + must not be a multiple of 3 unless both lengths are + multiples of 3. + +10. Strong emphasis begins with a delimiter that + [can open strong emphasis] and ends with a delimiter that + [can close strong emphasis], and that uses the same character + (`_` or `*`) as the opening delimiter. The + opening and closing delimiters must belong to separate + [delimiter runs]. If one of the delimiters can both open + and close strong emphasis, then the sum of the lengths of + the delimiter runs containing the opening and closing + delimiters must not be a multiple of 3 unless both lengths + are multiples of 3. + +11. A literal `*` character cannot occur at the beginning or end of + `*`-delimited emphasis or `**`-delimited strong emphasis, unless it + is backslash-escaped. + +12. A literal `_` character cannot occur at the beginning or end of + `_`-delimited emphasis or `__`-delimited strong emphasis, unless it + is backslash-escaped. + +Where rules 1--12 above are compatible with multiple parsings, +the following principles resolve ambiguity: + +13. The number of nestings should be minimized. Thus, for example, + an interpretation `...` is always preferred to + `...`. + +14. An interpretation `...` is always + preferred to `...`. + +15. When two potential emphasis or strong emphasis spans overlap, + so that the second begins before the first ends and ends after + the first ends, the first takes precedence. Thus, for example, + `*foo _bar* baz_` is parsed as `foo _bar baz_` rather + than `*foo bar* baz`. + +16. When there are two potential emphasis or strong emphasis spans + with the same closing delimiter, the shorter one (the one that + opens later) takes precedence. Thus, for example, + `**foo **bar baz**` is parsed as `**foo bar baz` + rather than `foo **bar baz`. + +17. Inline code spans, links, images, and HTML tags group more tightly + than emphasis. So, when there is a choice between an interpretation + that contains one of these elements and one that does not, the + former always wins. Thus, for example, `*[foo*](bar)` is + parsed as `*foo*` rather than as + `[foo](bar)`. + +These rules can be illustrated through a series of examples. + +Rule 1: + +```````````````````````````````` example +*foo bar* +. +

foo bar

+```````````````````````````````` + + +This is not emphasis, because the opening `*` is followed by +whitespace, and hence not part of a [left-flanking delimiter run]: + +```````````````````````````````` example +a * foo bar* +. +

a * foo bar*

+```````````````````````````````` + + +This is not emphasis, because the opening `*` is preceded +by an alphanumeric and followed by punctuation, and hence +not part of a [left-flanking delimiter run]: + +```````````````````````````````` example +a*"foo"* +. +

a*"foo"*

+```````````````````````````````` + + +Unicode nonbreaking spaces count as whitespace, too: + +```````````````````````````````` example +* a * +. +

* a *

+```````````````````````````````` + + +Intraword emphasis with `*` is permitted: + +```````````````````````````````` example +foo*bar* +. +

foobar

+```````````````````````````````` + + +```````````````````````````````` example +5*6*78 +. +

5678

+```````````````````````````````` + + +Rule 2: + +```````````````````````````````` example +_foo bar_ +. +

foo bar

+```````````````````````````````` + + +This is not emphasis, because the opening `_` is followed by +whitespace: + +```````````````````````````````` example +_ foo bar_ +. +

_ foo bar_

+```````````````````````````````` + + +This is not emphasis, because the opening `_` is preceded +by an alphanumeric and followed by punctuation: + +```````````````````````````````` example +a_"foo"_ +. +

a_"foo"_

+```````````````````````````````` + + +Emphasis with `_` is not allowed inside words: + +```````````````````````````````` example +foo_bar_ +. +

foo_bar_

+```````````````````````````````` + + +```````````````````````````````` example +5_6_78 +. +

5_6_78

+```````````````````````````````` + + +```````````````````````````````` example +пристаням_стремятся_ +. +

пристаням_стремятся_

+```````````````````````````````` + + +Here `_` does not generate emphasis, because the first delimiter run +is right-flanking and the second left-flanking: + +```````````````````````````````` example +aa_"bb"_cc +. +

aa_"bb"_cc

+```````````````````````````````` + + +This is emphasis, even though the opening delimiter is +both left- and right-flanking, because it is preceded by +punctuation: + +```````````````````````````````` example +foo-_(bar)_ +. +

foo-(bar)

+```````````````````````````````` + + +Rule 3: + +This is not emphasis, because the closing delimiter does +not match the opening delimiter: + +```````````````````````````````` example +_foo* +. +

_foo*

+```````````````````````````````` + + +This is not emphasis, because the closing `*` is preceded by +whitespace: + +```````````````````````````````` example +*foo bar * +. +

*foo bar *

+```````````````````````````````` + + +A newline also counts as whitespace: + +```````````````````````````````` example +*foo bar +* +. +

*foo bar +*

+```````````````````````````````` + + +This is not emphasis, because the second `*` is +preceded by punctuation and followed by an alphanumeric +(hence it is not part of a [right-flanking delimiter run]: + +```````````````````````````````` example +*(*foo) +. +

*(*foo)

+```````````````````````````````` + + +The point of this restriction is more easily appreciated +with this example: + +```````````````````````````````` example +*(*foo*)* +. +

(foo)

+```````````````````````````````` + + +Intraword emphasis with `*` is allowed: + +```````````````````````````````` example +*foo*bar +. +

foobar

+```````````````````````````````` + + + +Rule 4: + +This is not emphasis, because the closing `_` is preceded by +whitespace: + +```````````````````````````````` example +_foo bar _ +. +

_foo bar _

+```````````````````````````````` + + +This is not emphasis, because the second `_` is +preceded by punctuation and followed by an alphanumeric: + +```````````````````````````````` example +_(_foo) +. +

_(_foo)

+```````````````````````````````` + + +This is emphasis within emphasis: + +```````````````````````````````` example +_(_foo_)_ +. +

(foo)

+```````````````````````````````` + + +Intraword emphasis is disallowed for `_`: + +```````````````````````````````` example +_foo_bar +. +

_foo_bar

+```````````````````````````````` + + +```````````````````````````````` example +_пристаням_стремятся +. +

_пристаням_стремятся

+```````````````````````````````` + + +```````````````````````````````` example +_foo_bar_baz_ +. +

foo_bar_baz

+```````````````````````````````` + + +This is emphasis, even though the closing delimiter is +both left- and right-flanking, because it is followed by +punctuation: + +```````````````````````````````` example +_(bar)_. +. +

(bar).

+```````````````````````````````` + + +Rule 5: + +```````````````````````````````` example +**foo bar** +. +

foo bar

+```````````````````````````````` + + +This is not strong emphasis, because the opening delimiter is +followed by whitespace: + +```````````````````````````````` example +** foo bar** +. +

** foo bar**

+```````````````````````````````` + + +This is not strong emphasis, because the opening `**` is preceded +by an alphanumeric and followed by punctuation, and hence +not part of a [left-flanking delimiter run]: + +```````````````````````````````` example +a**"foo"** +. +

a**"foo"**

+```````````````````````````````` + + +Intraword strong emphasis with `**` is permitted: + +```````````````````````````````` example +foo**bar** +. +

foobar

+```````````````````````````````` + + +Rule 6: + +```````````````````````````````` example +__foo bar__ +. +

foo bar

+```````````````````````````````` + + +This is not strong emphasis, because the opening delimiter is +followed by whitespace: + +```````````````````````````````` example +__ foo bar__ +. +

__ foo bar__

+```````````````````````````````` + + +A newline counts as whitespace: +```````````````````````````````` example +__ +foo bar__ +. +

__ +foo bar__

+```````````````````````````````` + + +This is not strong emphasis, because the opening `__` is preceded +by an alphanumeric and followed by punctuation: + +```````````````````````````````` example +a__"foo"__ +. +

a__"foo"__

+```````````````````````````````` + + +Intraword strong emphasis is forbidden with `__`: + +```````````````````````````````` example +foo__bar__ +. +

foo__bar__

+```````````````````````````````` + + +```````````````````````````````` example +5__6__78 +. +

5__6__78

+```````````````````````````````` + + +```````````````````````````````` example +пристаням__стремятся__ +. +

пристаням__стремятся__

+```````````````````````````````` + + +```````````````````````````````` example +__foo, __bar__, baz__ +. +

foo, bar, baz

+```````````````````````````````` + + +This is strong emphasis, even though the opening delimiter is +both left- and right-flanking, because it is preceded by +punctuation: + +```````````````````````````````` example +foo-__(bar)__ +. +

foo-(bar)

+```````````````````````````````` + + + +Rule 7: + +This is not strong emphasis, because the closing delimiter is preceded +by whitespace: + +```````````````````````````````` example +**foo bar ** +. +

**foo bar **

+```````````````````````````````` + + +(Nor can it be interpreted as an emphasized `*foo bar *`, because of +Rule 11.) + +This is not strong emphasis, because the second `**` is +preceded by punctuation and followed by an alphanumeric: + +```````````````````````````````` example +**(**foo) +. +

**(**foo)

+```````````````````````````````` + + +The point of this restriction is more easily appreciated +with these examples: + +```````````````````````````````` example +*(**foo**)* +. +

(foo)

+```````````````````````````````` + + +```````````````````````````````` example +**Gomphocarpus (*Gomphocarpus physocarpus*, syn. +*Asclepias physocarpa*)** +. +

Gomphocarpus (Gomphocarpus physocarpus, syn. +Asclepias physocarpa)

+```````````````````````````````` + + +```````````````````````````````` example +**foo "*bar*" foo** +. +

foo "bar" foo

+```````````````````````````````` + + +Intraword emphasis: + +```````````````````````````````` example +**foo**bar +. +

foobar

+```````````````````````````````` + + +Rule 8: + +This is not strong emphasis, because the closing delimiter is +preceded by whitespace: + +```````````````````````````````` example +__foo bar __ +. +

__foo bar __

+```````````````````````````````` + + +This is not strong emphasis, because the second `__` is +preceded by punctuation and followed by an alphanumeric: + +```````````````````````````````` example +__(__foo) +. +

__(__foo)

+```````````````````````````````` + + +The point of this restriction is more easily appreciated +with this example: + +```````````````````````````````` example +_(__foo__)_ +. +

(foo)

+```````````````````````````````` + + +Intraword strong emphasis is forbidden with `__`: + +```````````````````````````````` example +__foo__bar +. +

__foo__bar

+```````````````````````````````` + + +```````````````````````````````` example +__пристаням__стремятся +. +

__пристаням__стремятся

+```````````````````````````````` + + +```````````````````````````````` example +__foo__bar__baz__ +. +

foo__bar__baz

+```````````````````````````````` + + +This is strong emphasis, even though the closing delimiter is +both left- and right-flanking, because it is followed by +punctuation: + +```````````````````````````````` example +__(bar)__. +. +

(bar).

+```````````````````````````````` + + +Rule 9: + +Any nonempty sequence of inline elements can be the contents of an +emphasized span. + +```````````````````````````````` example +*foo [bar](/url)* +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo +bar* +. +

foo +bar

+```````````````````````````````` + + +In particular, emphasis and strong emphasis can be nested +inside emphasis: + +```````````````````````````````` example +_foo __bar__ baz_ +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +_foo _bar_ baz_ +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +__foo_ bar_ +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo *bar** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo **bar** baz* +. +

foo bar baz

+```````````````````````````````` + +```````````````````````````````` example +*foo**bar**baz* +. +

foobarbaz

+```````````````````````````````` + +Note that in the preceding case, the interpretation + +``` markdown +

foobarbaz

+``` + + +is precluded by the condition that a delimiter that +can both open and close (like the `*` after `foo`) +cannot form emphasis if the sum of the lengths of +the delimiter runs containing the opening and +closing delimiters is a multiple of 3 unless +both lengths are multiples of 3. + + +For the same reason, we don't get two consecutive +emphasis sections in this example: + +```````````````````````````````` example +*foo**bar* +. +

foo**bar

+```````````````````````````````` + + +The same condition ensures that the following +cases are all strong emphasis nested inside +emphasis, even when the interior spaces are +omitted: + + +```````````````````````````````` example +***foo** bar* +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo **bar*** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo**bar*** +. +

foobar

+```````````````````````````````` + + +When the lengths of the interior closing and opening +delimiter runs are *both* multiples of 3, though, +they can match to create emphasis: + +```````````````````````````````` example +foo***bar***baz +. +

foobarbaz

+```````````````````````````````` + +```````````````````````````````` example +foo******bar*********baz +. +

foobar***baz

+```````````````````````````````` + + +Indefinite levels of nesting are possible: + +```````````````````````````````` example +*foo **bar *baz* bim** bop* +. +

foo bar baz bim bop

+```````````````````````````````` + + +```````````````````````````````` example +*foo [*bar*](/url)* +. +

foo bar

+```````````````````````````````` + + +There can be no empty emphasis or strong emphasis: + +```````````````````````````````` example +** is not an empty emphasis +. +

** is not an empty emphasis

+```````````````````````````````` + + +```````````````````````````````` example +**** is not an empty strong emphasis +. +

**** is not an empty strong emphasis

+```````````````````````````````` + + + +Rule 10: + +Any nonempty sequence of inline elements can be the contents of an +strongly emphasized span. + +```````````````````````````````` example +**foo [bar](/url)** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +**foo +bar** +. +

foo +bar

+```````````````````````````````` + + +In particular, emphasis and strong emphasis can be nested +inside strong emphasis: + +```````````````````````````````` example +__foo _bar_ baz__ +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +__foo __bar__ baz__ +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +____foo__ bar__ +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +**foo **bar**** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +**foo *bar* baz** +. +

foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +**foo*bar*baz** +. +

foobarbaz

+```````````````````````````````` + + +```````````````````````````````` example +***foo* bar** +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +**foo *bar*** +. +

foo bar

+```````````````````````````````` + + +Indefinite levels of nesting are possible: + +```````````````````````````````` example +**foo *bar **baz** +bim* bop** +. +

foo bar baz +bim bop

+```````````````````````````````` + + +```````````````````````````````` example +**foo [*bar*](/url)** +. +

foo bar

+```````````````````````````````` + + +There can be no empty emphasis or strong emphasis: + +```````````````````````````````` example +__ is not an empty emphasis +. +

__ is not an empty emphasis

+```````````````````````````````` + + +```````````````````````````````` example +____ is not an empty strong emphasis +. +

____ is not an empty strong emphasis

+```````````````````````````````` + + + +Rule 11: + +```````````````````````````````` example +foo *** +. +

foo ***

+```````````````````````````````` + + +```````````````````````````````` example +foo *\** +. +

foo *

+```````````````````````````````` + + +```````````````````````````````` example +foo *_* +. +

foo _

+```````````````````````````````` + + +```````````````````````````````` example +foo ***** +. +

foo *****

+```````````````````````````````` + + +```````````````````````````````` example +foo **\*** +. +

foo *

+```````````````````````````````` + + +```````````````````````````````` example +foo **_** +. +

foo _

+```````````````````````````````` + + +Note that when delimiters do not match evenly, Rule 11 determines +that the excess literal `*` characters will appear outside of the +emphasis, rather than inside it: + +```````````````````````````````` example +**foo* +. +

*foo

+```````````````````````````````` + + +```````````````````````````````` example +*foo** +. +

foo*

+```````````````````````````````` + + +```````````````````````````````` example +***foo** +. +

*foo

+```````````````````````````````` + + +```````````````````````````````` example +****foo* +. +

***foo

+```````````````````````````````` + + +```````````````````````````````` example +**foo*** +. +

foo*

+```````````````````````````````` + + +```````````````````````````````` example +*foo**** +. +

foo***

+```````````````````````````````` + + + +Rule 12: + +```````````````````````````````` example +foo ___ +. +

foo ___

+```````````````````````````````` + + +```````````````````````````````` example +foo _\__ +. +

foo _

+```````````````````````````````` + + +```````````````````````````````` example +foo _*_ +. +

foo *

+```````````````````````````````` + + +```````````````````````````````` example +foo _____ +. +

foo _____

+```````````````````````````````` + + +```````````````````````````````` example +foo __\___ +. +

foo _

+```````````````````````````````` + + +```````````````````````````````` example +foo __*__ +. +

foo *

+```````````````````````````````` + + +```````````````````````````````` example +__foo_ +. +

_foo

+```````````````````````````````` + + +Note that when delimiters do not match evenly, Rule 12 determines +that the excess literal `_` characters will appear outside of the +emphasis, rather than inside it: + +```````````````````````````````` example +_foo__ +. +

foo_

+```````````````````````````````` + + +```````````````````````````````` example +___foo__ +. +

_foo

+```````````````````````````````` + + +```````````````````````````````` example +____foo_ +. +

___foo

+```````````````````````````````` + + +```````````````````````````````` example +__foo___ +. +

foo_

+```````````````````````````````` + + +```````````````````````````````` example +_foo____ +. +

foo___

+```````````````````````````````` + + +Rule 13 implies that if you want emphasis nested directly inside +emphasis, you must use different delimiters: + +```````````````````````````````` example +**foo** +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +*_foo_* +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +__foo__ +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +_*foo*_ +. +

foo

+```````````````````````````````` + + +However, strong emphasis within strong emphasis is possible without +switching delimiters: + +```````````````````````````````` example +****foo**** +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +____foo____ +. +

foo

+```````````````````````````````` + + + +Rule 13 can be applied to arbitrarily long sequences of +delimiters: + +```````````````````````````````` example +******foo****** +. +

foo

+```````````````````````````````` + + +Rule 14: + +```````````````````````````````` example +***foo*** +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +_____foo_____ +. +

foo

+```````````````````````````````` + + +Rule 15: + +```````````````````````````````` example +*foo _bar* baz_ +. +

foo _bar baz_

+```````````````````````````````` + + +```````````````````````````````` example +*foo __bar *baz bim__ bam* +. +

foo bar *baz bim bam

+```````````````````````````````` + + +Rule 16: + +```````````````````````````````` example +**foo **bar baz** +. +

**foo bar baz

+```````````````````````````````` + + +```````````````````````````````` example +*foo *bar baz* +. +

*foo bar baz

+```````````````````````````````` + + +Rule 17: + +```````````````````````````````` example +*[bar*](/url) +. +

*bar*

+```````````````````````````````` + + +```````````````````````````````` example +_foo [bar_](/url) +. +

_foo bar_

+```````````````````````````````` + + +```````````````````````````````` example +* +. +

*

+```````````````````````````````` + + +```````````````````````````````` example +** +. +

**

+```````````````````````````````` + + +```````````````````````````````` example +__ +. +

__

+```````````````````````````````` + + +```````````````````````````````` example +*a `*`* +. +

a *

+```````````````````````````````` + + +```````````````````````````````` example +_a `_`_ +. +

a _

+```````````````````````````````` + + +```````````````````````````````` example +**a +. +

**ahttp://foo.bar/?q=**

+```````````````````````````````` + + +```````````````````````````````` example +__a +. +

__ahttp://foo.bar/?q=__

+```````````````````````````````` + + + +## Links + +A link contains [link text] (the visible text), a [link destination] +(the URI that is the link destination), and optionally a [link title]. +There are two basic kinds of links in Markdown. In [inline links] the +destination and title are given immediately after the link text. In +[reference links] the destination and title are defined elsewhere in +the document. + +A [link text](@) consists of a sequence of zero or more +inline elements enclosed by square brackets (`[` and `]`). The +following rules apply: + +- Links may not contain other links, at any level of nesting. If + multiple otherwise valid link definitions appear nested inside each + other, the inner-most definition is used. + +- Brackets are allowed in the [link text] only if (a) they + are backslash-escaped or (b) they appear as a matched pair of brackets, + with an open bracket `[`, a sequence of zero or more inlines, and + a close bracket `]`. + +- Backtick [code spans], [autolinks], and raw [HTML tags] bind more tightly + than the brackets in link text. Thus, for example, + `` [foo`]` `` could not be a link text, since the second `]` + is part of a code span. + +- The brackets in link text bind more tightly than markers for + [emphasis and strong emphasis]. Thus, for example, `*[foo*](url)` is a link. + +A [link destination](@) consists of either + +- a sequence of zero or more characters between an opening `<` and a + closing `>` that contains no line breaks or unescaped + `<` or `>` characters, or + +- a nonempty sequence of characters that does not start with + `<`, does not include ASCII space or control characters, and + includes parentheses only if (a) they are backslash-escaped or + (b) they are part of a balanced pair of unescaped parentheses. + (Implementations may impose limits on parentheses nesting to + avoid performance issues, but at least three levels of nesting + should be supported.) + +A [link title](@) consists of either + +- a sequence of zero or more characters between straight double-quote + characters (`"`), including a `"` character only if it is + backslash-escaped, or + +- a sequence of zero or more characters between straight single-quote + characters (`'`), including a `'` character only if it is + backslash-escaped, or + +- a sequence of zero or more characters between matching parentheses + (`(...)`), including a `(` or `)` character only if it is + backslash-escaped. + +Although [link titles] may span multiple lines, they may not contain +a [blank line]. + +An [inline link](@) consists of a [link text] followed immediately +by a left parenthesis `(`, optional [whitespace], an optional +[link destination], an optional [link title] separated from the link +destination by [whitespace], optional [whitespace], and a right +parenthesis `)`. The link's text consists of the inlines contained +in the [link text] (excluding the enclosing square brackets). +The link's URI consists of the link destination, excluding enclosing +`<...>` if present, with backslash-escapes in effect as described +above. The link's title consists of the link title, excluding its +enclosing delimiters, with backslash-escapes in effect as described +above. + +Here is a simple inline link: + +```````````````````````````````` example +[link](/uri "title") +. +

link

+```````````````````````````````` + + +The title may be omitted: + +```````````````````````````````` example +[link](/uri) +. +

link

+```````````````````````````````` + + +Both the title and the destination may be omitted: + +```````````````````````````````` example +[link]() +. +

link

+```````````````````````````````` + + +```````````````````````````````` example +[link](<>) +. +

link

+```````````````````````````````` + +The destination can only contain spaces if it is +enclosed in pointy brackets: + +```````````````````````````````` example +[link](/my uri) +. +

[link](/my uri)

+```````````````````````````````` + +```````````````````````````````` example +[link](
) +. +

link

+```````````````````````````````` + +The destination cannot contain line breaks, +even if enclosed in pointy brackets: + +```````````````````````````````` example +[link](foo +bar) +. +

[link](foo +bar)

+```````````````````````````````` + +```````````````````````````````` example +[link]() +. +

[link]()

+```````````````````````````````` + +The destination can contain `)` if it is enclosed +in pointy brackets: + +```````````````````````````````` example +[a]() +. +

a

+```````````````````````````````` + +Pointy brackets that enclose links must be unescaped: + +```````````````````````````````` example +[link]() +. +

[link](<foo>)

+```````````````````````````````` + +These are not links, because the opening pointy bracket +is not matched properly: + +```````````````````````````````` example +[a]( +[a](c) +. +

[a](<b)c +[a](<b)c> +[a](c)

+```````````````````````````````` + +Parentheses inside the link destination may be escaped: + +```````````````````````````````` example +[link](\(foo\)) +. +

link

+```````````````````````````````` + +Any number of parentheses are allowed without escaping, as long as they are +balanced: + +```````````````````````````````` example +[link](foo(and(bar))) +. +

link

+```````````````````````````````` + +However, if you have unbalanced parentheses, you need to escape or use the +`<...>` form: + +```````````````````````````````` example +[link](foo\(and\(bar\)) +. +

link

+```````````````````````````````` + + +```````````````````````````````` example +[link]() +. +

link

+```````````````````````````````` + + +Parentheses and other symbols can also be escaped, as usual +in Markdown: + +```````````````````````````````` example +[link](foo\)\:) +. +

link

+```````````````````````````````` + + +A link can contain fragment identifiers and queries: + +```````````````````````````````` example +[link](#fragment) + +[link](http://example.com#fragment) + +[link](http://example.com?foo=3#frag) +. +

link

+

link

+

link

+```````````````````````````````` + + +Note that a backslash before a non-escapable character is +just a backslash: + +```````````````````````````````` example +[link](foo\bar) +. +

link

+```````````````````````````````` + + +URL-escaping should be left alone inside the destination, as all +URL-escaped characters are also valid URL characters. Entity and +numerical character references in the destination will be parsed +into the corresponding Unicode code points, as usual. These may +be optionally URL-escaped when written as HTML, but this spec +does not enforce any particular policy for rendering URLs in +HTML or other formats. Renderers may make different decisions +about how to escape or normalize URLs in the output. + +```````````````````````````````` example +[link](foo%20bä) +. +

link

+```````````````````````````````` + + +Note that, because titles can often be parsed as destinations, +if you try to omit the destination and keep the title, you'll +get unexpected results: + +```````````````````````````````` example +[link]("title") +. +

link

+```````````````````````````````` + + +Titles may be in single quotes, double quotes, or parentheses: + +```````````````````````````````` example +[link](/url "title") +[link](/url 'title') +[link](/url (title)) +. +

link +link +link

+```````````````````````````````` + + +Backslash escapes and entity and numeric character references +may be used in titles: + +```````````````````````````````` example +[link](/url "title \""") +. +

link

+```````````````````````````````` + + +Titles must be separated from the link using a [whitespace]. +Other [Unicode whitespace] like non-breaking space doesn't work. + +```````````````````````````````` example +[link](/url "title") +. +

link

+```````````````````````````````` + + +Nested balanced quotes are not allowed without escaping: + +```````````````````````````````` example +[link](/url "title "and" title") +. +

[link](/url "title "and" title")

+```````````````````````````````` + + +But it is easy to work around this by using a different quote type: + +```````````````````````````````` example +[link](/url 'title "and" title') +. +

link

+```````````````````````````````` + + +(Note: `Markdown.pl` did allow double quotes inside a double-quoted +title, and its test suite included a test demonstrating this. +But it is hard to see a good rationale for the extra complexity this +brings, since there are already many ways---backslash escaping, +entity and numeric character references, or using a different +quote type for the enclosing title---to write titles containing +double quotes. `Markdown.pl`'s handling of titles has a number +of other strange features. For example, it allows single-quoted +titles in inline links, but not reference links. And, in +reference links but not inline links, it allows a title to begin +with `"` and end with `)`. `Markdown.pl` 1.0.1 even allows +titles with no closing quotation mark, though 1.0.2b8 does not. +It seems preferable to adopt a simple, rational rule that works +the same way in inline links and link reference definitions.) + +[Whitespace] is allowed around the destination and title: + +```````````````````````````````` example +[link]( /uri + "title" ) +. +

link

+```````````````````````````````` + + +But it is not allowed between the link text and the +following parenthesis: + +```````````````````````````````` example +[link] (/uri) +. +

[link] (/uri)

+```````````````````````````````` + + +The link text may contain balanced brackets, but not unbalanced ones, +unless they are escaped: + +```````````````````````````````` example +[link [foo [bar]]](/uri) +. +

link [foo [bar]]

+```````````````````````````````` + + +```````````````````````````````` example +[link] bar](/uri) +. +

[link] bar](/uri)

+```````````````````````````````` + + +```````````````````````````````` example +[link [bar](/uri) +. +

[link bar

+```````````````````````````````` + + +```````````````````````````````` example +[link \[bar](/uri) +. +

link [bar

+```````````````````````````````` + + +The link text may contain inline content: + +```````````````````````````````` example +[link *foo **bar** `#`*](/uri) +. +

link foo bar #

+```````````````````````````````` + + +```````````````````````````````` example +[![moon](moon.jpg)](/uri) +. +

moon

+```````````````````````````````` + + +However, links may not contain other links, at any level of nesting. + +```````````````````````````````` example +[foo [bar](/uri)](/uri) +. +

[foo bar](/uri)

+```````````````````````````````` + + +```````````````````````````````` example +[foo *[bar [baz](/uri)](/uri)*](/uri) +. +

[foo [bar baz](/uri)](/uri)

+```````````````````````````````` + + +```````````````````````````````` example +![[[foo](uri1)](uri2)](uri3) +. +

[foo](uri2)

+```````````````````````````````` + + +These cases illustrate the precedence of link text grouping over +emphasis grouping: + +```````````````````````````````` example +*[foo*](/uri) +. +

*foo*

+```````````````````````````````` + + +```````````````````````````````` example +[foo *bar](baz*) +. +

foo *bar

+```````````````````````````````` + + +Note that brackets that *aren't* part of links do not take +precedence: + +```````````````````````````````` example +*foo [bar* baz] +. +

foo [bar baz]

+```````````````````````````````` + + +These cases illustrate the precedence of HTML tags, code spans, +and autolinks over link grouping: + +```````````````````````````````` example +[foo +. +

[foo

+```````````````````````````````` + + +```````````````````````````````` example +[foo`](/uri)` +. +

[foo](/uri)

+```````````````````````````````` + + +```````````````````````````````` example +[foo +. +

[foohttp://example.com/?search=](uri)

+```````````````````````````````` + + +There are three kinds of [reference link](@)s: +[full](#full-reference-link), [collapsed](#collapsed-reference-link), +and [shortcut](#shortcut-reference-link). + +A [full reference link](@) +consists of a [link text] immediately followed by a [link label] +that [matches] a [link reference definition] elsewhere in the document. + +A [link label](@) begins with a left bracket (`[`) and ends +with the first right bracket (`]`) that is not backslash-escaped. +Between these brackets there must be at least one [non-whitespace character]. +Unescaped square bracket characters are not allowed inside the +opening and closing square brackets of [link labels]. A link +label can have at most 999 characters inside the square +brackets. + +One label [matches](@) +another just in case their normalized forms are equal. To normalize a +label, strip off the opening and closing brackets, +perform the *Unicode case fold*, strip leading and trailing +[whitespace] and collapse consecutive internal +[whitespace] to a single space. If there are multiple +matching reference link definitions, the one that comes first in the +document is used. (It is desirable in such cases to emit a warning.) + +The contents of the first link label are parsed as inlines, which are +used as the link's text. The link's URI and title are provided by the +matching [link reference definition]. + +Here is a simple example: + +```````````````````````````````` example +[foo][bar] + +[bar]: /url "title" +. +

foo

+```````````````````````````````` + + +The rules for the [link text] are the same as with +[inline links]. Thus: + +The link text may contain balanced brackets, but not unbalanced ones, +unless they are escaped: + +```````````````````````````````` example +[link [foo [bar]]][ref] + +[ref]: /uri +. +

link [foo [bar]]

+```````````````````````````````` + + +```````````````````````````````` example +[link \[bar][ref] + +[ref]: /uri +. +

link [bar

+```````````````````````````````` + + +The link text may contain inline content: + +```````````````````````````````` example +[link *foo **bar** `#`*][ref] + +[ref]: /uri +. +

link foo bar #

+```````````````````````````````` + + +```````````````````````````````` example +[![moon](moon.jpg)][ref] + +[ref]: /uri +. +

moon

+```````````````````````````````` + + +However, links may not contain other links, at any level of nesting. + +```````````````````````````````` example +[foo [bar](/uri)][ref] + +[ref]: /uri +. +

[foo bar]ref

+```````````````````````````````` + + +```````````````````````````````` example +[foo *bar [baz][ref]*][ref] + +[ref]: /uri +. +

[foo bar baz]ref

+```````````````````````````````` + + +(In the examples above, we have two [shortcut reference links] +instead of one [full reference link].) + +The following cases illustrate the precedence of link text grouping over +emphasis grouping: + +```````````````````````````````` example +*[foo*][ref] + +[ref]: /uri +. +

*foo*

+```````````````````````````````` + + +```````````````````````````````` example +[foo *bar][ref] + +[ref]: /uri +. +

foo *bar

+```````````````````````````````` + + +These cases illustrate the precedence of HTML tags, code spans, +and autolinks over link grouping: + +```````````````````````````````` example +[foo + +[ref]: /uri +. +

[foo

+```````````````````````````````` + + +```````````````````````````````` example +[foo`][ref]` + +[ref]: /uri +. +

[foo][ref]

+```````````````````````````````` + + +```````````````````````````````` example +[foo + +[ref]: /uri +. +

[foohttp://example.com/?search=][ref]

+```````````````````````````````` + + +Matching is case-insensitive: + +```````````````````````````````` example +[foo][BaR] + +[bar]: /url "title" +. +

foo

+```````````````````````````````` + + +Unicode case fold is used: + +```````````````````````````````` example +[Толпой][Толпой] is a Russian word. + +[ТОЛПОЙ]: /url +. +

Толпой is a Russian word.

+```````````````````````````````` + + +Consecutive internal [whitespace] is treated as one space for +purposes of determining matching: + +```````````````````````````````` example +[Foo + bar]: /url + +[Baz][Foo bar] +. +

Baz

+```````````````````````````````` + + +No [whitespace] is allowed between the [link text] and the +[link label]: + +```````````````````````````````` example +[foo] [bar] + +[bar]: /url "title" +. +

[foo] bar

+```````````````````````````````` + + +```````````````````````````````` example +[foo] +[bar] + +[bar]: /url "title" +. +

[foo] +bar

+```````````````````````````````` + + +This is a departure from John Gruber's original Markdown syntax +description, which explicitly allows whitespace between the link +text and the link label. It brings reference links in line with +[inline links], which (according to both original Markdown and +this spec) cannot have whitespace after the link text. More +importantly, it prevents inadvertent capture of consecutive +[shortcut reference links]. If whitespace is allowed between the +link text and the link label, then in the following we will have +a single reference link, not two shortcut reference links, as +intended: + +``` markdown +[foo] +[bar] + +[foo]: /url1 +[bar]: /url2 +``` + +(Note that [shortcut reference links] were introduced by Gruber +himself in a beta version of `Markdown.pl`, but never included +in the official syntax description. Without shortcut reference +links, it is harmless to allow space between the link text and +link label; but once shortcut references are introduced, it is +too dangerous to allow this, as it frequently leads to +unintended results.) + +When there are multiple matching [link reference definitions], +the first is used: + +```````````````````````````````` example +[foo]: /url1 + +[foo]: /url2 + +[bar][foo] +. +

bar

+```````````````````````````````` + + +Note that matching is performed on normalized strings, not parsed +inline content. So the following does not match, even though the +labels define equivalent inline content: + +```````````````````````````````` example +[bar][foo\!] + +[foo!]: /url +. +

[bar][foo!]

+```````````````````````````````` + + +[Link labels] cannot contain brackets, unless they are +backslash-escaped: + +```````````````````````````````` example +[foo][ref[] + +[ref[]: /uri +. +

[foo][ref[]

+

[ref[]: /uri

+```````````````````````````````` + + +```````````````````````````````` example +[foo][ref[bar]] + +[ref[bar]]: /uri +. +

[foo][ref[bar]]

+

[ref[bar]]: /uri

+```````````````````````````````` + + +```````````````````````````````` example +[[[foo]]] + +[[[foo]]]: /url +. +

[[[foo]]]

+

[[[foo]]]: /url

+```````````````````````````````` + + +```````````````````````````````` example +[foo][ref\[] + +[ref\[]: /uri +. +

foo

+```````````````````````````````` + + +Note that in this example `]` is not backslash-escaped: + +```````````````````````````````` example +[bar\\]: /uri + +[bar\\] +. +

bar\

+```````````````````````````````` + + +A [link label] must contain at least one [non-whitespace character]: + +```````````````````````````````` example +[] + +[]: /uri +. +

[]

+

[]: /uri

+```````````````````````````````` + + +```````````````````````````````` example +[ + ] + +[ + ]: /uri +. +

[ +]

+

[ +]: /uri

+```````````````````````````````` + + +A [collapsed reference link](@) +consists of a [link label] that [matches] a +[link reference definition] elsewhere in the +document, followed by the string `[]`. +The contents of the first link label are parsed as inlines, +which are used as the link's text. The link's URI and title are +provided by the matching reference link definition. Thus, +`[foo][]` is equivalent to `[foo][foo]`. + +```````````````````````````````` example +[foo][] + +[foo]: /url "title" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[*foo* bar][] + +[*foo* bar]: /url "title" +. +

foo bar

+```````````````````````````````` + + +The link labels are case-insensitive: + +```````````````````````````````` example +[Foo][] + +[foo]: /url "title" +. +

Foo

+```````````````````````````````` + + + +As with full reference links, [whitespace] is not +allowed between the two sets of brackets: + +```````````````````````````````` example +[foo] +[] + +[foo]: /url "title" +. +

foo +[]

+```````````````````````````````` + + +A [shortcut reference link](@) +consists of a [link label] that [matches] a +[link reference definition] elsewhere in the +document and is not followed by `[]` or a link label. +The contents of the first link label are parsed as inlines, +which are used as the link's text. The link's URI and title +are provided by the matching link reference definition. +Thus, `[foo]` is equivalent to `[foo][]`. + +```````````````````````````````` example +[foo] + +[foo]: /url "title" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +[*foo* bar] + +[*foo* bar]: /url "title" +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +[[*foo* bar]] + +[*foo* bar]: /url "title" +. +

[foo bar]

+```````````````````````````````` + + +```````````````````````````````` example +[[bar [foo] + +[foo]: /url +. +

[[bar foo

+```````````````````````````````` + + +The link labels are case-insensitive: + +```````````````````````````````` example +[Foo] + +[foo]: /url "title" +. +

Foo

+```````````````````````````````` + + +A space after the link text should be preserved: + +```````````````````````````````` example +[foo] bar + +[foo]: /url +. +

foo bar

+```````````````````````````````` + + +If you just want bracketed text, you can backslash-escape the +opening bracket to avoid links: + +```````````````````````````````` example +\[foo] + +[foo]: /url "title" +. +

[foo]

+```````````````````````````````` + + +Note that this is a link, because a link label ends with the first +following closing bracket: + +```````````````````````````````` example +[foo*]: /url + +*[foo*] +. +

*foo*

+```````````````````````````````` + + +Full and compact references take precedence over shortcut +references: + +```````````````````````````````` example +[foo][bar] + +[foo]: /url1 +[bar]: /url2 +. +

foo

+```````````````````````````````` + +```````````````````````````````` example +[foo][] + +[foo]: /url1 +. +

foo

+```````````````````````````````` + +Inline links also take precedence: + +```````````````````````````````` example +[foo]() + +[foo]: /url1 +. +

foo

+```````````````````````````````` + +```````````````````````````````` example +[foo](not a link) + +[foo]: /url1 +. +

foo(not a link)

+```````````````````````````````` + +In the following case `[bar][baz]` is parsed as a reference, +`[foo]` as normal text: + +```````````````````````````````` example +[foo][bar][baz] + +[baz]: /url +. +

[foo]bar

+```````````````````````````````` + + +Here, though, `[foo][bar]` is parsed as a reference, since +`[bar]` is defined: + +```````````````````````````````` example +[foo][bar][baz] + +[baz]: /url1 +[bar]: /url2 +. +

foobaz

+```````````````````````````````` + + +Here `[foo]` is not parsed as a shortcut reference, because it +is followed by a link label (even though `[bar]` is not defined): + +```````````````````````````````` example +[foo][bar][baz] + +[baz]: /url1 +[foo]: /url2 +. +

[foo]bar

+```````````````````````````````` + + + +## Images + +Syntax for images is like the syntax for links, with one +difference. Instead of [link text], we have an +[image description](@). The rules for this are the +same as for [link text], except that (a) an +image description starts with `![` rather than `[`, and +(b) an image description may contain links. +An image description has inline elements +as its contents. When an image is rendered to HTML, +this is standardly used as the image's `alt` attribute. + +```````````````````````````````` example +![foo](/url "title") +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![foo *bar*] + +[foo *bar*]: train.jpg "train & tracks" +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo ![bar](/url)](/url2) +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo [bar](/url)](/url2) +. +

foo bar

+```````````````````````````````` + + +Though this spec is concerned with parsing, not rendering, it is +recommended that in rendering to HTML, only the plain string content +of the [image description] be used. Note that in +the above example, the alt attribute's value is `foo bar`, not `foo +[bar](/url)` or `foo bar`. Only the plain string +content is rendered, without formatting. + +```````````````````````````````` example +![foo *bar*][] + +[foo *bar*]: train.jpg "train & tracks" +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo *bar*][foobar] + +[FOOBAR]: train.jpg "train & tracks" +. +

foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo](train.jpg) +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +My ![foo bar](/path/to/train.jpg "title" ) +. +

My foo bar

+```````````````````````````````` + + +```````````````````````````````` example +![foo]() +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![](/url) +. +

+```````````````````````````````` + + +Reference-style: + +```````````````````````````````` example +![foo][bar] + +[bar]: /url +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![foo][bar] + +[BAR]: /url +. +

foo

+```````````````````````````````` + + +Collapsed: + +```````````````````````````````` example +![foo][] + +[foo]: /url "title" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![*foo* bar][] + +[*foo* bar]: /url "title" +. +

foo bar

+```````````````````````````````` + + +The labels are case-insensitive: + +```````````````````````````````` example +![Foo][] + +[foo]: /url "title" +. +

Foo

+```````````````````````````````` + + +As with reference links, [whitespace] is not allowed +between the two sets of brackets: + +```````````````````````````````` example +![foo] +[] + +[foo]: /url "title" +. +

foo +[]

+```````````````````````````````` + + +Shortcut: + +```````````````````````````````` example +![foo] + +[foo]: /url "title" +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +![*foo* bar] + +[*foo* bar]: /url "title" +. +

foo bar

+```````````````````````````````` + + +Note that link labels cannot contain unescaped brackets: + +```````````````````````````````` example +![[foo]] + +[[foo]]: /url "title" +. +

![[foo]]

+

[[foo]]: /url "title"

+```````````````````````````````` + + +The link labels are case-insensitive: + +```````````````````````````````` example +![Foo] + +[foo]: /url "title" +. +

Foo

+```````````````````````````````` + + +If you just want a literal `!` followed by bracketed text, you can +backslash-escape the opening `[`: + +```````````````````````````````` example +!\[foo] + +[foo]: /url "title" +. +

![foo]

+```````````````````````````````` + + +If you want a link after a literal `!`, backslash-escape the +`!`: + +```````````````````````````````` example +\![foo] + +[foo]: /url "title" +. +

!foo

+```````````````````````````````` + + +## Autolinks + +[Autolink](@)s are absolute URIs and email addresses inside +`<` and `>`. They are parsed as links, with the URL or email address +as the link label. + +A [URI autolink](@) consists of `<`, followed by an +[absolute URI] followed by `>`. It is parsed as +a link to the URI, with the URI as the link's label. + +An [absolute URI](@), +for these purposes, consists of a [scheme] followed by a colon (`:`) +followed by zero or more characters other than ASCII +[whitespace] and control characters, `<`, and `>`. If +the URI includes these characters, they must be percent-encoded +(e.g. `%20` for a space). + +For purposes of this spec, a [scheme](@) is any sequence +of 2--32 characters beginning with an ASCII letter and followed +by any combination of ASCII letters, digits, or the symbols plus +("+"), period ("."), or hyphen ("-"). + +Here are some valid autolinks: + +```````````````````````````````` example + +. +

http://foo.bar.baz

+```````````````````````````````` + + +```````````````````````````````` example + +. +

http://foo.bar.baz/test?q=hello&id=22&boolean

+```````````````````````````````` + + +```````````````````````````````` example + +. +

irc://foo.bar:2233/baz

+```````````````````````````````` + + +Uppercase is also fine: + +```````````````````````````````` example + +. +

MAILTO:FOO@BAR.BAZ

+```````````````````````````````` + + +Note that many strings that count as [absolute URIs] for +purposes of this spec are not valid URIs, because their +schemes are not registered or because of other problems +with their syntax: + +```````````````````````````````` example + +. +

a+b+c:d

+```````````````````````````````` + + +```````````````````````````````` example + +. +

made-up-scheme://foo,bar

+```````````````````````````````` + + +```````````````````````````````` example + +. +

http://../

+```````````````````````````````` + + +```````````````````````````````` example + +. +

localhost:5001/foo

+```````````````````````````````` + + +Spaces are not allowed in autolinks: + +```````````````````````````````` example + +. +

<http://foo.bar/baz bim>

+```````````````````````````````` + + +Backslash-escapes do not work inside autolinks: + +```````````````````````````````` example + +. +

http://example.com/\[\

+```````````````````````````````` + + +An [email autolink](@) +consists of `<`, followed by an [email address], +followed by `>`. The link's label is the email address, +and the URL is `mailto:` followed by the email address. + +An [email address](@), +for these purposes, is anything that matches +the [non-normative regex from the HTML5 +spec](https://html.spec.whatwg.org/multipage/forms.html#e-mail-state-(type=email)): + + /^[a-zA-Z0-9.!#$%&'*+/=?^_`{|}~-]+@[a-zA-Z0-9](?:[a-zA-Z0-9-]{0,61}[a-zA-Z0-9])? + (?:\.[a-zA-Z0-9](?:[a-zA-Z0-9-]{0,61}[a-zA-Z0-9])?)*$/ + +Examples of email autolinks: + +```````````````````````````````` example + +. +

foo@bar.example.com

+```````````````````````````````` + + +```````````````````````````````` example + +. +

foo+special@Bar.baz-bar0.com

+```````````````````````````````` + + +Backslash-escapes do not work inside email autolinks: + +```````````````````````````````` example + +. +

<foo+@bar.example.com>

+```````````````````````````````` + + +These are not autolinks: + +```````````````````````````````` example +<> +. +

<>

+```````````````````````````````` + + +```````````````````````````````` example +< http://foo.bar > +. +

< http://foo.bar >

+```````````````````````````````` + + +```````````````````````````````` example + +. +

<m:abc>

+```````````````````````````````` + + +```````````````````````````````` example + +. +

<foo.bar.baz>

+```````````````````````````````` + + +```````````````````````````````` example +http://example.com +. +

http://example.com

+```````````````````````````````` + + +```````````````````````````````` example +foo@bar.example.com +. +

foo@bar.example.com

+```````````````````````````````` + + +## Raw HTML + +Text between `<` and `>` that looks like an HTML tag is parsed as a +raw HTML tag and will be rendered in HTML without escaping. +Tag and attribute names are not limited to current HTML tags, +so custom tags (and even, say, DocBook tags) may be used. + +Here is the grammar for tags: + +A [tag name](@) consists of an ASCII letter +followed by zero or more ASCII letters, digits, or +hyphens (`-`). + +An [attribute](@) consists of [whitespace], +an [attribute name], and an optional +[attribute value specification]. + +An [attribute name](@) +consists of an ASCII letter, `_`, or `:`, followed by zero or more ASCII +letters, digits, `_`, `.`, `:`, or `-`. (Note: This is the XML +specification restricted to ASCII. HTML5 is laxer.) + +An [attribute value specification](@) +consists of optional [whitespace], +a `=` character, optional [whitespace], and an [attribute +value]. + +An [attribute value](@) +consists of an [unquoted attribute value], +a [single-quoted attribute value], or a [double-quoted attribute value]. + +An [unquoted attribute value](@) +is a nonempty string of characters not +including [whitespace], `"`, `'`, `=`, `<`, `>`, or `` ` ``. + +A [single-quoted attribute value](@) +consists of `'`, zero or more +characters not including `'`, and a final `'`. + +A [double-quoted attribute value](@) +consists of `"`, zero or more +characters not including `"`, and a final `"`. + +An [open tag](@) consists of a `<` character, a [tag name], +zero or more [attributes], optional [whitespace], an optional `/` +character, and a `>` character. + +A [closing tag](@) consists of the string ``. + +An [HTML comment](@) consists of ``, +where *text* does not start with `>` or `->`, does not end with `-`, +and does not contain `--`. (See the +[HTML5 spec](http://www.w3.org/TR/html5/syntax.html#comments).) + +A [processing instruction](@) +consists of the string ``, and the string +`?>`. + +A [declaration](@) consists of the +string ``, and the character `>`. + +A [CDATA section](@) consists of +the string ``, and the string `]]>`. + +An [HTML tag](@) consists of an [open tag], a [closing tag], +an [HTML comment], a [processing instruction], a [declaration], +or a [CDATA section]. + +Here are some simple open tags: + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +Empty elements: + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +[Whitespace] is allowed: + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +With attributes: + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +Custom tag names can be used: + +```````````````````````````````` example +Foo +. +

Foo

+```````````````````````````````` + + +Illegal tag names, not parsed as HTML: + +```````````````````````````````` example +<33> <__> +. +

<33> <__>

+```````````````````````````````` + + +Illegal attribute names: + +```````````````````````````````` example +
+. +

<a h*#ref="hi">

+```````````````````````````````` + + +Illegal attribute values: + +```````````````````````````````` example +
+. +

</a href="foo">

+```````````````````````````````` + + +Comments: + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +foo +. +

foo <!-- not a comment -- two hyphens -->

+```````````````````````````````` + + +Not comments: + +```````````````````````````````` example +foo foo --> + +foo +. +

foo <!--> foo -->

+

foo <!-- foo--->

+```````````````````````````````` + + +Processing instructions: + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +Declarations: + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +CDATA sections: + +```````````````````````````````` example +foo &<]]> +. +

foo &<]]>

+```````````````````````````````` + + +Entity and numeric character references are preserved in HTML +attributes: + +```````````````````````````````` example +foo
+. +

foo

+```````````````````````````````` + + +Backslash escapes do not work in HTML attributes: + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example + +. +

<a href=""">

+```````````````````````````````` + + +## Hard line breaks + +A line break (not in a code span or HTML tag) that is preceded +by two or more spaces and does not occur at the end of a block +is parsed as a [hard line break](@) (rendered +in HTML as a `
` tag): + +```````````````````````````````` example +foo +baz +. +

foo
+baz

+```````````````````````````````` + + +For a more visible alternative, a backslash before the +[line ending] may be used instead of two spaces: + +```````````````````````````````` example +foo\ +baz +. +

foo
+baz

+```````````````````````````````` + + +More than two spaces can be used: + +```````````````````````````````` example +foo +baz +. +

foo
+baz

+```````````````````````````````` + + +Leading spaces at the beginning of the next line are ignored: + +```````````````````````````````` example +foo + bar +. +

foo
+bar

+```````````````````````````````` + + +```````````````````````````````` example +foo\ + bar +. +

foo
+bar

+```````````````````````````````` + + +Line breaks can occur inside emphasis, links, and other constructs +that allow inline content: + +```````````````````````````````` example +*foo +bar* +. +

foo
+bar

+```````````````````````````````` + + +```````````````````````````````` example +*foo\ +bar* +. +

foo
+bar

+```````````````````````````````` + + +Line breaks do not occur inside code spans + +```````````````````````````````` example +`code +span` +. +

code span

+```````````````````````````````` + + +```````````````````````````````` example +`code\ +span` +. +

code\ span

+```````````````````````````````` + + +or HTML tags: + +```````````````````````````````` example +
+. +

+```````````````````````````````` + + +```````````````````````````````` example + +. +

+```````````````````````````````` + + +Hard line breaks are for separating inline content within a block. +Neither syntax for hard line breaks works at the end of a paragraph or +other block element: + +```````````````````````````````` example +foo\ +. +

foo\

+```````````````````````````````` + + +```````````````````````````````` example +foo +. +

foo

+```````````````````````````````` + + +```````````````````````````````` example +### foo\ +. +

foo\

+```````````````````````````````` + + +```````````````````````````````` example +### foo +. +

foo

+```````````````````````````````` + + +## Soft line breaks + +A regular line break (not in a code span or HTML tag) that is not +preceded by two or more spaces or a backslash is parsed as a +[softbreak](@). (A softbreak may be rendered in HTML either as a +[line ending] or as a space. The result will be the same in +browsers. In the examples here, a [line ending] will be used.) + +```````````````````````````````` example +foo +baz +. +

foo +baz

+```````````````````````````````` + + +Spaces at the end of the line and beginning of the next line are +removed: + +```````````````````````````````` example +foo + baz +. +

foo +baz

+```````````````````````````````` + + +A conforming parser may render a soft line break in HTML either as a +line break or as a space. + +A renderer may also provide an option to render soft line breaks +as hard line breaks. + +## Textual content + +Any characters not given an interpretation by the above rules will +be parsed as plain textual content. + +```````````````````````````````` example +hello $.;'there +. +

hello $.;'there

+```````````````````````````````` + + +```````````````````````````````` example +Foo χρῆν +. +

Foo χρῆν

+```````````````````````````````` + + +Internal spaces are preserved verbatim: + +```````````````````````````````` example +Multiple spaces +. +

Multiple spaces

+```````````````````````````````` + + + + +# Appendix: A parsing strategy + +In this appendix we describe some features of the parsing strategy +used in the CommonMark reference implementations. + +## Overview + +Parsing has two phases: + +1. In the first phase, lines of input are consumed and the block +structure of the document---its division into paragraphs, block quotes, +list items, and so on---is constructed. Text is assigned to these +blocks but not parsed. Link reference definitions are parsed and a +map of links is constructed. + +2. In the second phase, the raw text contents of paragraphs and headings +are parsed into sequences of Markdown inline elements (strings, +code spans, links, emphasis, and so on), using the map of link +references constructed in phase 1. + +At each point in processing, the document is represented as a tree of +**blocks**. The root of the tree is a `document` block. The `document` +may have any number of other blocks as **children**. These children +may, in turn, have other blocks as children. The last child of a block +is normally considered **open**, meaning that subsequent lines of input +can alter its contents. (Blocks that are not open are **closed**.) +Here, for example, is a possible document tree, with the open blocks +marked by arrows: + +``` tree +-> document + -> block_quote + paragraph + "Lorem ipsum dolor\nsit amet." + -> list (type=bullet tight=true bullet_char=-) + list_item + paragraph + "Qui *quodsi iracundia*" + -> list_item + -> paragraph + "aliquando id" +``` + +## Phase 1: block structure + +Each line that is processed has an effect on this tree. The line is +analyzed and, depending on its contents, the document may be altered +in one or more of the following ways: + +1. One or more open blocks may be closed. +2. One or more new blocks may be created as children of the + last open block. +3. Text may be added to the last (deepest) open block remaining + on the tree. + +Once a line has been incorporated into the tree in this way, +it can be discarded, so input can be read in a stream. + +For each line, we follow this procedure: + +1. First we iterate through the open blocks, starting with the +root document, and descending through last children down to the last +open block. Each block imposes a condition that the line must satisfy +if the block is to remain open. For example, a block quote requires a +`>` character. A paragraph requires a non-blank line. +In this phase we may match all or just some of the open +blocks. But we cannot close unmatched blocks yet, because we may have a +[lazy continuation line]. + +2. Next, after consuming the continuation markers for existing +blocks, we look for new block starts (e.g. `>` for a block quote). +If we encounter a new block start, we close any blocks unmatched +in step 1 before creating the new block as a child of the last +matched block. + +3. Finally, we look at the remainder of the line (after block +markers like `>`, list markers, and indentation have been consumed). +This is text that can be incorporated into the last open +block (a paragraph, code block, heading, or raw HTML). + +Setext headings are formed when we see a line of a paragraph +that is a [setext heading underline]. + +Reference link definitions are detected when a paragraph is closed; +the accumulated text lines are parsed to see if they begin with +one or more reference link definitions. Any remainder becomes a +normal paragraph. + +We can see how this works by considering how the tree above is +generated by four lines of Markdown: + +``` markdown +> Lorem ipsum dolor +sit amet. +> - Qui *quodsi iracundia* +> - aliquando id +``` + +At the outset, our document model is just + +``` tree +-> document +``` + +The first line of our text, + +``` markdown +> Lorem ipsum dolor +``` + +causes a `block_quote` block to be created as a child of our +open `document` block, and a `paragraph` block as a child of +the `block_quote`. Then the text is added to the last open +block, the `paragraph`: + +``` tree +-> document + -> block_quote + -> paragraph + "Lorem ipsum dolor" +``` + +The next line, + +``` markdown +sit amet. +``` + +is a "lazy continuation" of the open `paragraph`, so it gets added +to the paragraph's text: + +``` tree +-> document + -> block_quote + -> paragraph + "Lorem ipsum dolor\nsit amet." +``` + +The third line, + +``` markdown +> - Qui *quodsi iracundia* +``` + +causes the `paragraph` block to be closed, and a new `list` block +opened as a child of the `block_quote`. A `list_item` is also +added as a child of the `list`, and a `paragraph` as a child of +the `list_item`. The text is then added to the new `paragraph`: + +``` tree +-> document + -> block_quote + paragraph + "Lorem ipsum dolor\nsit amet." + -> list (type=bullet tight=true bullet_char=-) + -> list_item + -> paragraph + "Qui *quodsi iracundia*" +``` + +The fourth line, + +``` markdown +> - aliquando id +``` + +causes the `list_item` (and its child the `paragraph`) to be closed, +and a new `list_item` opened up as child of the `list`. A `paragraph` +is added as a child of the new `list_item`, to contain the text. +We thus obtain the final tree: + +``` tree +-> document + -> block_quote + paragraph + "Lorem ipsum dolor\nsit amet." + -> list (type=bullet tight=true bullet_char=-) + list_item + paragraph + "Qui *quodsi iracundia*" + -> list_item + -> paragraph + "aliquando id" +``` + +## Phase 2: inline structure + +Once all of the input has been parsed, all open blocks are closed. + +We then "walk the tree," visiting every node, and parse raw +string contents of paragraphs and headings as inlines. At this +point we have seen all the link reference definitions, so we can +resolve reference links as we go. + +``` tree +document + block_quote + paragraph + str "Lorem ipsum dolor" + softbreak + str "sit amet." + list (type=bullet tight=true bullet_char=-) + list_item + paragraph + str "Qui " + emph + str "quodsi iracundia" + list_item + paragraph + str "aliquando id" +``` + +Notice how the [line ending] in the first paragraph has +been parsed as a `softbreak`, and the asterisks in the first list item +have become an `emph`. + +### An algorithm for parsing nested emphasis and links + +By far the trickiest part of inline parsing is handling emphasis, +strong emphasis, links, and images. This is done using the following +algorithm. + +When we're parsing inlines and we hit either + +- a run of `*` or `_` characters, or +- a `[` or `![` + +we insert a text node with these symbols as its literal content, and we +add a pointer to this text node to the [delimiter stack](@). + +The [delimiter stack] is a doubly linked list. Each +element contains a pointer to a text node, plus information about + +- the type of delimiter (`[`, `![`, `*`, `_`) +- the number of delimiters, +- whether the delimiter is "active" (all are active to start), and +- whether the delimiter is a potential opener, a potential closer, + or both (which depends on what sort of characters precede + and follow the delimiters). + +When we hit a `]` character, we call the *look for link or image* +procedure (see below). + +When we hit the end of the input, we call the *process emphasis* +procedure (see below), with `stack_bottom` = NULL. + +#### *look for link or image* + +Starting at the top of the delimiter stack, we look backwards +through the stack for an opening `[` or `![` delimiter. + +- If we don't find one, we return a literal text node `]`. + +- If we do find one, but it's not *active*, we remove the inactive + delimiter from the stack, and return a literal text node `]`. + +- If we find one and it's active, then we parse ahead to see if + we have an inline link/image, reference link/image, compact reference + link/image, or shortcut reference link/image. + + + If we don't, then we remove the opening delimiter from the + delimiter stack and return a literal text node `]`. + + + If we do, then + + * We return a link or image node whose children are the inlines + after the text node pointed to by the opening delimiter. + + * We run *process emphasis* on these inlines, with the `[` opener + as `stack_bottom`. + + * We remove the opening delimiter. + + * If we have a link (and not an image), we also set all + `[` delimiters before the opening delimiter to *inactive*. (This + will prevent us from getting links within links.) + +#### *process emphasis* + +Parameter `stack_bottom` sets a lower bound to how far we +descend in the [delimiter stack]. If it is NULL, we can +go all the way to the bottom. Otherwise, we stop before +visiting `stack_bottom`. + +Let `current_position` point to the element on the [delimiter stack] +just above `stack_bottom` (or the first element if `stack_bottom` +is NULL). + +We keep track of the `openers_bottom` for each delimiter +type (`*`, `_`) and each length of the closing delimiter run +(modulo 3). Initialize this to `stack_bottom`. + +Then we repeat the following until we run out of potential +closers: + +- Move `current_position` forward in the delimiter stack (if needed) + until we find the first potential closer with delimiter `*` or `_`. + (This will be the potential closer closest + to the beginning of the input -- the first one in parse order.) + +- Now, look back in the stack (staying above `stack_bottom` and + the `openers_bottom` for this delimiter type) for the + first matching potential opener ("matching" means same delimiter). + +- If one is found: + + + Figure out whether we have emphasis or strong emphasis: + if both closer and opener spans have length >= 2, we have + strong, otherwise regular. + + + Insert an emph or strong emph node accordingly, after + the text node corresponding to the opener. + + + Remove any delimiters between the opener and closer from + the delimiter stack. + + + Remove 1 (for regular emph) or 2 (for strong emph) delimiters + from the opening and closing text nodes. If they become empty + as a result, remove them and remove the corresponding element + of the delimiter stack. If the closing node is removed, reset + `current_position` to the next element in the stack. + +- If none is found: + + + Set `openers_bottom` to the element before `current_position`. + (We know that there are no openers for this kind of closer up to and + including this point, so this puts a lower bound on future searches.) + + + If the closer at `current_position` is not a potential opener, + remove it from the delimiter stack (since we know it can't + be a closer either). + + + Advance `current_position` to the next element in the stack. + +After we're done, we remove all delimiters above `stack_bottom` from the +delimiter stack. + diff --git a/_benchmark/go/benchmark_test.go b/_benchmark/go/benchmark_test.go new file mode 100644 index 0000000..da38915 --- /dev/null +++ b/_benchmark/go/benchmark_test.go @@ -0,0 +1,95 @@ +package benchmark + +import ( + "bytes" + "io/ioutil" + "testing" + + gomarkdown "github.com/gomarkdown/markdown" + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/util" + "gitlab.com/golang-commonmark/markdown" + + "github.com/russross/blackfriday/v2" + + "github.com/88250/lute" +) + +func BenchmarkMarkdown(b *testing.B) { + b.Run("Blackfriday-v2", func(b *testing.B) { + r := func(src []byte) ([]byte, error) { + out := blackfriday.Run(src) + return out, nil + } + doBenchmark(b, r) + }) + + b.Run("GoldMark", func(b *testing.B) { + markdown := goldmark.New( + goldmark.WithRendererOptions(html.WithXHTML(), html.WithUnsafe()), + ) + r := func(src []byte) ([]byte, error) { + var out bytes.Buffer + err := markdown.Convert(src, &out) + return out.Bytes(), err + } + doBenchmark(b, r) + }) + + b.Run("CommonMark", func(b *testing.B) { + md := markdown.New(markdown.XHTMLOutput(true)) + r := func(src []byte) ([]byte, error) { + var out bytes.Buffer + err := md.Render(&out, src) + return out.Bytes(), err + } + doBenchmark(b, r) + }) + + b.Run("Lute", func(b *testing.B) { + luteEngine := lute.New() + luteEngine.SetGFMAutoLink(false) + luteEngine.SetGFMStrikethrough(false) + luteEngine.SetGFMTable(false) + luteEngine.SetGFMTaskListItem(false) + luteEngine.SetCodeSyntaxHighlight(false) + luteEngine.SetSoftBreak2HardBreak(false) + luteEngine.SetAutoSpace(false) + luteEngine.SetFixTermTypo(false) + r := func(src []byte) ([]byte, error) { + out := luteEngine.MarkdownStr("Benchmark", util.BytesToReadOnlyString(src)) + return util.StringToReadOnlyBytes(out), nil + } + doBenchmark(b, r) + }) + + b.Run("GoMarkdown", func(b *testing.B) { + r := func(src []byte) ([]byte, error) { + out := gomarkdown.ToHTML(src, nil, nil) + return out, nil + } + doBenchmark(b, r) + }) + +} + +// The different frameworks have different APIs. Create an adapter that +// should behave the same in the memory department. +func doBenchmark(b *testing.B, render func(src []byte) ([]byte, error)) { + b.StopTimer() + source, err := ioutil.ReadFile("_data.md") + if err != nil { + b.Fatal(err) + } + b.StartTimer() + for i := 0; i < b.N; i++ { + out, err := render(source) + if err != nil { + b.Fatal(err) + } + if len(out) < 100 { + b.Fatal("No result") + } + } +} diff --git a/_benchmark/go/go.mod b/_benchmark/go/go.mod new file mode 100644 index 0000000..a213b87 --- /dev/null +++ b/_benchmark/go/go.mod @@ -0,0 +1,28 @@ +module banchmark + +go 1.22 + +toolchain go1.22.9 + +require ( + github.com/88250/lute v1.7.5 + github.com/gomarkdown/markdown v0.0.0-20230322041520-c84983bdbf2a + github.com/russross/blackfriday/v2 v2.1.0 + github.com/yuin/goldmark v0.0.0 + gitlab.com/golang-commonmark/markdown v0.0.0-20211110145824-bf3e522c626a +) + +require ( + github.com/alecthomas/chroma v0.10.0 // indirect + github.com/dlclark/regexp2 v1.10.0 // indirect + github.com/gopherjs/gopherjs v1.17.2 // indirect + gitlab.com/golang-commonmark/html v0.0.0-20191124015941-a22733972181 // indirect + gitlab.com/golang-commonmark/linkify v0.0.0-20191026162114-a0c2df6c8f82 // indirect + gitlab.com/golang-commonmark/mdurl v0.0.0-20191124015652-932350d1cb84 // indirect + gitlab.com/golang-commonmark/puny v0.0.0-20191124015043-9f83538fa04f // indirect + golang.org/x/text v0.10.0 // indirect +) + +replace gopkg.in/russross/blackfriday.v2 v2.0.1 => github.com/russross/blackfriday/v2 v2.0.1 + +replace github.com/yuin/goldmark v0.0.0 => ../../ diff --git a/_benchmark/go/go.sum b/_benchmark/go/go.sum new file mode 100644 index 0000000..3fb3b3e --- /dev/null +++ b/_benchmark/go/go.sum @@ -0,0 +1,40 @@ +github.com/88250/lute v1.7.5 h1:mcPFURh5sK1WH1kFRjqK5DkMWOfVN2BhyrXitN8GmpQ= +github.com/88250/lute v1.7.5/go.mod h1:cEoBGi0zArPqAsp0MdG9SKinvH/xxZZWXU7sRx8vHSA= +github.com/alecthomas/chroma v0.10.0 h1:7XDcGkCQopCNKjZHfYrNLraA+M7e0fMiJ/Mfikbfjek= +github.com/alecthomas/chroma v0.10.0/go.mod h1:jtJATyUxlIORhUOFNA9NZDWGAQ8wpxQQqNSB4rjA/1s= +github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= +github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/dlclark/regexp2 v1.4.0/go.mod h1:2pZnwuY/m+8K6iRw6wQdMtk+rH5tNGR1i55kozfMjCc= +github.com/dlclark/regexp2 v1.10.0 h1:+/GIL799phkJqYW+3YbOd8LCcbHzT0Pbo8zl70MHsq0= +github.com/dlclark/regexp2 v1.10.0/go.mod h1:DHkYz0B9wPfa6wondMfaivmHpzrQ3v9q8cnmRbL6yW8= +github.com/gomarkdown/markdown v0.0.0-20230322041520-c84983bdbf2a h1:AWZzzFrqyjYlRloN6edwTLTUbKxf5flLXNuTBDm3Ews= +github.com/gomarkdown/markdown v0.0.0-20230322041520-c84983bdbf2a/go.mod h1:JDGcbDT52eL4fju3sZ4TeHGsQwhG9nbDV21aMyhwPoA= +github.com/gopherjs/gopherjs v1.17.2 h1:fQnZVsXk8uxXIStYb0N4bGk7jeyTalG/wsZjQ25dO0g= +github.com/gopherjs/gopherjs v1.17.2/go.mod h1:pRRIvn/QzFLrKfvEz3qUuEhtE/zLCWfreZ6J5gM2i+k= +github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= +github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= +github.com/russross/blackfriday/v2 v2.1.0 h1:JIOH55/0cWyOuilr9/qlrm0BSXldqnqwMsf35Ld67mk= +github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM= +github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= +github.com/stretchr/testify v1.7.0 h1:nwc3DEeHmmLAfoZucVR881uASk0Mfjw8xYJ99tb5CcY= +github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= +gitlab.com/golang-commonmark/html v0.0.0-20191124015941-a22733972181 h1:K+bMSIx9A7mLES1rtG+qKduLIXq40DAzYHtb0XuCukA= +gitlab.com/golang-commonmark/html v0.0.0-20191124015941-a22733972181/go.mod h1:dzYhVIwWCtzPAa4QP98wfB9+mzt33MSmM8wsKiMi2ow= +gitlab.com/golang-commonmark/linkify v0.0.0-20191026162114-a0c2df6c8f82 h1:oYrL81N608MLZhma3ruL8qTM4xcpYECGut8KSxRY59g= +gitlab.com/golang-commonmark/linkify v0.0.0-20191026162114-a0c2df6c8f82/go.mod h1:Gn+LZmCrhPECMD3SOKlE+BOHwhOYD9j7WT9NUtkCrC8= +gitlab.com/golang-commonmark/markdown v0.0.0-20211110145824-bf3e522c626a h1:O85GKETcmnCNAfv4Aym9tepU8OE0NmcZNqPlXcsBKBs= +gitlab.com/golang-commonmark/markdown v0.0.0-20211110145824-bf3e522c626a/go.mod h1:LaSIs30YPGs1H5jwGgPhLzc8vkNc/k0rDX/fEZqiU/M= +gitlab.com/golang-commonmark/mdurl v0.0.0-20191124015652-932350d1cb84 h1:qqjvoVXdWIcZCLPMlzgA7P9FZWdPGPvP/l3ef8GzV6o= +gitlab.com/golang-commonmark/mdurl v0.0.0-20191124015652-932350d1cb84/go.mod h1:IJZ+fdMvbW2qW6htJx7sLJ04FEs4Ldl/MDsJtMKywfw= +gitlab.com/golang-commonmark/puny v0.0.0-20191124015043-9f83538fa04f h1:Wku8eEdeJqIOFHtrfkYUByc4bCaTeA6fL0UJgfEiFMI= +gitlab.com/golang-commonmark/puny v0.0.0-20191124015043-9f83538fa04f/go.mod h1:Tiuhl+njh/JIg0uS/sOJVYi0x2HEa5rc1OAaVsb5tAs= +gitlab.com/opennota/wd v0.0.0-20180912061657-c5d65f63c638 h1:uPZaMiz6Sz0PZs3IZJWpU5qHKGNy///1pacZC9txiUI= +gitlab.com/opennota/wd v0.0.0-20180912061657-c5d65f63c638/go.mod h1:EGRJaqe2eO9XGmFtQCvV3Lm9NLico3UhFwUpCG/+mVU= +golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/text v0.10.0 h1:UpjohKhiEgNc0CSauXmwYftY1+LlaC75SJwh0SgCX58= +golang.org/x/text v0.10.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= +golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= +gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= +gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c h1:dUUwHk2QECo/6vqA44rthZ8ie2QXMNeKRTHCNY2nXvo= +gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/_test/extra.txt b/_test/extra.txt new file mode 100644 index 0000000..b69772c --- /dev/null +++ b/_test/extra.txt @@ -0,0 +1,885 @@ +1 +//- - - - - - - - -// +* A + B +//- - - - - - - - -// +
    +
  • A +B
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +2 +//- - - - - - - - -// +**test**\ +test**test**\ +**test**test\ +test**test** +//- - - - - - - - -// +

test
+testtest
+testtest
+testtest

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +3 +//- - - - - - - - -// +>* > +> 1 +> 2 +>3 +//- - - - - - - - -// +
+
    +
  • +
    +
    +
  • +
+

1 +2 +3

+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +4 +//- - - - - - - - -// +`test`a`test` +//- - - - - - - - -// +

testatest

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +5 +//- - - - - - - - -// +_**TL/DR** - [Go see summary.](#my-summary-area)_ +//- - - - - - - - -// +

TL/DR - Go see summary.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +6 +//- - - - - - - - -// +[This link won't be rendered +correctly](https://geeksocket.in/some-long-link-here "This is the +place where everything breaks") +//- - - - - - - - -// +

This link won't be rendered +correctly

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +7 +//- - - - - - - - -// +[](./target.md) +//- - - - - - - - -// +

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +8 +//- - - - - - - - -// +[]() +//- - - - - - - - -// +

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +9 +//- - - - - - - - -// +[daß] is the old german spelling of [dass] + +[daß]: www.das-dass.de +//- - - - - - - - -// +

daß is the old german spelling of dass

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +10 +//- - - - - - - - -// +1. First step. + + ~~~ + aaa + --- + bbb + ~~~ + +2. few other steps. +//- - - - - - - - -// +
    +
  1. +

    First step.

    +
    aaa
    +---
    +bbb
    +
    +
  2. +
  3. +

    few other steps.

    +
  4. +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +11: delimiters between ascii punctuations should be parsed +//- - - - - - - - -// +`{%`_name_`%}` +//- - - - - - - - -// +

{%name%}

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +12: the alt attribute of img should be escaped +//- - - - - - - - -// +!["](quot.jpg) +!['](apos.jpg) +![<](lt.jpg) +![>](gt.jpg) +![&](amp.jpg) +//- - - - - - - - -// +

" +' +< +> +&

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +13: fenced code block starting with tab inside list +//- - - - - - - - -// +* foo + ```Makefile + foo + foo + ``` +//- - - - - - - - -// +
    +
  • foo +
    foo
    +	foo
    +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +14: fenced code block inside list, mismatched tab start +//- - - - - - - - -// +* foo + ```Makefile + foo + foo + ``` +//- - - - - - - - -// +
    +
  • foo +
    foo
    +  foo
    +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +15: fenced code block inside nested list +//- - - - - - - - -// +* foo + - bar + ```Makefile + foo + foo + ``` +//- - - - - - - - -// +
    +
  • foo +
      +
    • bar +
      foo
      +	foo
      +
      +
    • +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +16: indented code block starting with a tab. +//- - - - - - - - -// +* foo + + foo + foo + +//- - - - - - - - -// +
    +
  • +

    foo

    +
    foo
    +	foo
    +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +17: fenced code block in list, empty line, spaces on start +//- - - - - - - - -// +* foo + ```Makefile + foo + + foo + ``` +//- - - - - - - - -// +
    +
  • foo +
    foo
    +
    +foo
    +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +18: fenced code block in list, empty line, no spaces on start +//- - - - - - - - -// +* foo + ```Makefile + foo + + foo + ``` +//- - - - - - - - -// +
    +
  • foo +
    foo
    +
    +foo
    +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +19: fenced code block inside nested list, empty line, spaces on start +//- - - - - - - - -// +* foo + - bar + ```Makefile + foo + + foo + ``` +//- - - - - - - - -// +
    +
  • foo +
      +
    • bar +
      foo
      +
      +foo
      +
      +
    • +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +20: fenced code block inside nested list, empty line, no space on start +//- - - - - - - - -// +* foo + - bar + ```Makefile + foo + + foo + ``` +//- - - - - - - - -// +
    +
  • foo +
      +
    • bar +
      foo
      +
      +foo
      +
      +
    • +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +21: Fenced code block within list can start with tab +//- - - - - - - - -// +- List + + ``` + A + B + C + ``` +//- - - - - - - - -// +
    +
  • +

    List

    +
    A
    +	B
    +C
    +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +22: Indented code block within list can start with tab +//- - - - - - - - -// +- List + + A + B + C + +a +//- - - - - - - - -// +
    +
  • +

    List

    +
    A
    +	B
    +C
    +
    +
  • +
+

a

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +23: Emphasis corner case(yuin/goldmark#245) +//- - - - - - - - -// +a* b c d *e* +//- - - - - - - - -// +

a* b c d e

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +24: HTML block tags can contain trailing spaces +//- - - - - - - - -// + +//- - - - - - - - -// + +//= = = = = = = = = = = = = = = = = = = = = = = =// + +25: Indented code blocks can start with tab +//- - - - - - - - -// + x +//- - - - - - - - -// +
	x
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +26: NUL bytes must be replaced with U+FFFD + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +hello\x00world + +hello\ufffdworld

+

+

x

+

x

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +28: Single # is a heading level 1 +//- - - - - - - - -// +# +//- - - - - - - - -// +

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +29: An empty list item cannot interrupt a paragraph +//- - - - - - - - -// +x +* +//- - - - - - - - -// +

x +*

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +30: A link reference definition followed by a single quote without closer +//- - - - - - - - -// +[x] + +[x]: <> +' +//- - - - - - - - -// +

x

+

'

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +31: A link reference definition followed by a double quote without closer +//- - - - - - - - -// +[x] + +[x]: <> +" +//- - - - - - - - -// +

x

+

"

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +32: Hex character entities must be limited to 6 characters +//- - - - - - - - -// +A +//- - - - - - - - -// +

&#x0000041;

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +33: \x01 should be escaped all the time + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +[x](\x01) +//- - - - - - - - -// +

x

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +34: A form feed should not be treated as a space + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +x \f +//- - - - - - - - -// +

x \f

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +35: A link reference definition can contain a new line +//- - - - - - - - -// +This is a [test][foo +bar] 1...2..3... + +[foo bar]: / +//- - - - - - - - -// +

This is a test 1...2..3...

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +36: Emphasis and links +//- - - - - - - - -// +_a[b_c_](d) +//- - - - - - - - -// +

_ab_c_

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +37: Tabs and spaces + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +\t\t x\n +//- - - - - - - - -// +
\t x\n
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +38: Decimal HTML entity literals should allow 7 digits +//- - - - - - - - -// +� +//- - - - - - - - -// +

\uFFFD

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +39: Decimal HTML entities should not be interpreted as octal when starting with a 0 +//- - - - - - - - -// +d +//- - - - - - - - -// +

d

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +40: Invalid HTML tag names +//- - - - - - - - -// +<1> + + + + + +< p> +//- - - - - - - - -// +

<1>

+

<a:>

+

<a\f>

+

< p>

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +41: Link references can not contain spaces after link label +//- - - - - - - - -// +[x] +:> + +[o] :x +//- - - - - - - - -// +

[x] +:>

+

[o] :x

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +42: Unclosed link reference titles can interrupt link references +//- - - - - - - - -// +[r]: +<> +' + +[o]: +x +' +//- - - - - - - - -// +

'

+

'

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +43: A link containing an image containing a link should disable the outer link +//- - - - - - - - -// +[ ![ [b](c) ](x) ](y) +//- - - - - - - - -// +

[  b ](y)

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +44: An empty list item(with trailing spaces) cannot interrupt a paragraph +//- - - - - - - - -// +a +* +//- - - - - - - - -// +

a +*

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +45: Multiple empty list items +//- - - - - - - - -// +- + +- +//- - - - - - - - -// +
    +
  • +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +46: Vertical tab should not be treated as spaces + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +\v +//- - - - - - - - -// +

\v

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +47: Escape back slashes should not be treated as hard line breaks +//- - - - - - - - -// +\\\\ +a +//- - - - - - - - -// +

\ +a

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +48: Multiple paragraphs in tight list +//- - - - - - - - -// +- a + > + b +//- - - - - - - - -// +
    +
  • a +
    +
    +b
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +49: A list item that is indented up to 3 spaces after an empty list item +//- - - - - - - - -// +1. + + 1. b + +- + + - b +//- - - - - - - - -// +
    +
  1. +
  2. +

    b

    +
  3. +
+
    +
  • +
  • +

    b

    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +50: Spaces before a visible hard linebreak should be preserved +//- - - - - - - - -// +a \ +b +//- - - - - - - - -// +

a
+b

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +51: Empty line in a fenced code block under list items +//- - - - - - - - -// +* This is a list item + ``` + This is a test + + This line will be dropped. + This line will be displayed. + ``` +//- - - - - - - - -// +
    +
  • This is a list item +
    This is a test
    +
    +This line will be dropped.
    +This line will be displayed.
    +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +52: windows-style newline and HTMLs + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +link + + +//- - - - - - - - -// +

link

+ +//= = = = = = = = = = = = = = = = = = = = = = = =// + + +53: HTML comment without trailing new lines + OPTIONS: {"trim": true} +//- - - - - - - - -// + +//- - - - - - - - -// + +//= = = = = = = = = = = = = = = = = = = = = = = =// + + +54: Escaped characters followed by a null character + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +\\\x00\" +//- - - - - - - - -// +

\\\ufffd"

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +55: inline HTML comment +//- - - - - - - - -// +a c + +a +//- - - - - - - - -// +

a c

+

a

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +56: An empty list followed by blockquote +//- - - - - - - - -// +1. +> This is a quote. +//- - - - - - - - -// +
    +
  1. +
+
+

This is a quote.

+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +57: Tabbed fenced code block within a list +//- - - - - - - - -// +1. + ``` + ``` +//- - - - - - - - -// +
    +
  1. +
    +
  2. +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +58: HTML end tag without trailing new lines + OPTIONS: {"trim": true} +//- - - - - - - - -// +
+
+//- - - - - - - - -// +
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +59: Raw HTML tag with one new line +//- - - - - - - - -// + +//- - - - - - - - -// +

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +60: Raw HTML tag with multiple new lines +//- - - - - - - - -// + +//- - - - - - - - -// +

<img src=./.assets/logo.svg

+

/>

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +61: Image alt with a new line +//- - - - - - - - -// +![alt +text](logo.png) +//- - - - - - - - -// +

alt
+text

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +62: Image alt with an escaped character +//- - - - - - - - -// +![\`alt](https://example.com/img.png) +//- - - - - - - - -// +

`alt

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +63: Emphasis in link label +//- - - - - - - - -// +[*[a]*](b) +//- - - - - - - - -// +

[a]

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +64: Nested list under an empty list item +//- - - - - - - - -// +- + - foo +//- - - - - - - - -// +
    +
  • +
      +
    • foo
    • +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +65: Nested fenced code block with tab +//- - - - - - - - -// +> ``` +> 0 +> ``` +//- - - - - - - - -// +
+
 0
+
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +66: EOF should be rendered as a newline with an unclosed block(w/ TAB) +//- - - - - - - - -// +> ``` +> 0 +//- - - - - - - - -// +
+
 0
+
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +67: EOF should be rendered as a newline with an unclosed block +//- - - - - - - - -// +> ``` +> 0 +//- - - - - - - - -// +
+
 0
+
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +68: HTML comments in list items +//- - - - - - - - -// +- test + +- test2 +//- - - - - - - - -// +
    +
  • test + +
  • +
  • test2
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +69: Negative indentation with tabs in fenced code block + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +* +\t ~~~ +\t0 +//- - - - - - - - -// +
    +
  • +
    0
    +
    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +70: Single letter ATX heading +//- - - - - - - - -// +# A +//- - - - - - - - -// +

A

+//= = = = = = = = = = = = = = = = = = = = = = = =// diff --git a/_test/options.txt b/_test/options.txt new file mode 100644 index 0000000..3137b65 --- /dev/null +++ b/_test/options.txt @@ -0,0 +1,78 @@ +1 +//- - - - - - - - -// +## Title 0 + +## Title1 # {#id_1 .class-1} + +## Title2 {#id_2} + +## Title3 ## {#id_3 .class-3} + +## Title4 ## {data-attr3=value3} + +## Title5 ## {#id_5 data-attr5=value5} + +## Title6 ## {#id_6 .class6 data-attr6=value6} + +## Title7 ## {#id_7 data-attr7="value \"7"} + +## Title8 {#id .className data-attrName=attrValue class="class1 class2"} +//- - - - - - - - -// +

Title 0

+

Title1

+

Title2

+

Title3

+

Title4

+

Title5

+

Title6

+

Title7

+

Title8

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +2 +//- - - - - - - - -// +# +# FOO +//- - - - - - - - -// +

+

FOO

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +3 +//- - - - - - - - -// +## `records(self, zone, params={})` +//- - - - - - - - -// +

records(self, zone, params={})

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +4 +//- - - - - - - - -// +## Test {#hey .sort,class=fine,class=shell} Doesn't matter +//- - - - - - - - -// +

Test {#hey .sort,class=fine,class=shell} Doesn't matter

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +5 +//- - - - - - - - -// +## Test ## {#hey .sort,class=fine,class=shell} Doesn't matter +//- - - - - - - - -// +

Test ## {#hey .sort,class=fine,class=shell} Doesn't matter

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +6: class must be a string +//- - - - - - - - -// +# Test ## {class=0#.} +//- - - - - - - - -// +

Test ## {class=0#.}

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +7: short handed ids can contain hyphens ("-"), underscores ("_"), colons (":"), and periods (".") +//- - - - - - - - -// +# Test ## {#id-foo_bar:baz.qux .foobar} +//- - - - - - - - -// +

Test

+//= = = = = = = = = = = = = = = = = = = = = = = =// diff --git a/_test/spec.json b/_test/spec.json new file mode 100644 index 0000000..1f89e66 --- /dev/null +++ b/_test/spec.json @@ -0,0 +1,5218 @@ +[ + { + "markdown": "\tfoo\tbaz\t\tbim\n", + "html": "
foo\tbaz\t\tbim\n
\n", + "example": 1, + "start_line": 355, + "end_line": 360, + "section": "Tabs" + }, + { + "markdown": " \tfoo\tbaz\t\tbim\n", + "html": "
foo\tbaz\t\tbim\n
\n", + "example": 2, + "start_line": 362, + "end_line": 367, + "section": "Tabs" + }, + { + "markdown": " a\ta\n ὐ\ta\n", + "html": "
a\ta\nὐ\ta\n
\n", + "example": 3, + "start_line": 369, + "end_line": 376, + "section": "Tabs" + }, + { + "markdown": " - foo\n\n\tbar\n", + "html": "
    \n
  • \n

    foo

    \n

    bar

    \n
  • \n
\n", + "example": 4, + "start_line": 382, + "end_line": 393, + "section": "Tabs" + }, + { + "markdown": "- foo\n\n\t\tbar\n", + "html": "
    \n
  • \n

    foo

    \n
      bar\n
    \n
  • \n
\n", + "example": 5, + "start_line": 395, + "end_line": 407, + "section": "Tabs" + }, + { + "markdown": ">\t\tfoo\n", + "html": "
\n
  foo\n
\n
\n", + "example": 6, + "start_line": 418, + "end_line": 425, + "section": "Tabs" + }, + { + "markdown": "-\t\tfoo\n", + "html": "
    \n
  • \n
      foo\n
    \n
  • \n
\n", + "example": 7, + "start_line": 427, + "end_line": 436, + "section": "Tabs" + }, + { + "markdown": " foo\n\tbar\n", + "html": "
foo\nbar\n
\n", + "example": 8, + "start_line": 439, + "end_line": 446, + "section": "Tabs" + }, + { + "markdown": " - foo\n - bar\n\t - baz\n", + "html": "
    \n
  • foo\n
      \n
    • bar\n
        \n
      • baz
      • \n
      \n
    • \n
    \n
  • \n
\n", + "example": 9, + "start_line": 448, + "end_line": 464, + "section": "Tabs" + }, + { + "markdown": "#\tFoo\n", + "html": "

Foo

\n", + "example": 10, + "start_line": 466, + "end_line": 470, + "section": "Tabs" + }, + { + "markdown": "*\t*\t*\t\n", + "html": "
\n", + "example": 11, + "start_line": 472, + "end_line": 476, + "section": "Tabs" + }, + { + "markdown": "\\!\\\"\\#\\$\\%\\&\\'\\(\\)\\*\\+\\,\\-\\.\\/\\:\\;\\<\\=\\>\\?\\@\\[\\\\\\]\\^\\_\\`\\{\\|\\}\\~\n", + "html": "

!"#$%&'()*+,-./:;<=>?@[\\]^_`{|}~

\n", + "example": 12, + "start_line": 489, + "end_line": 493, + "section": "Backslash escapes" + }, + { + "markdown": "\\\t\\A\\a\\ \\3\\φ\\«\n", + "html": "

\\\t\\A\\a\\ \\3\\φ\\«

\n", + "example": 13, + "start_line": 499, + "end_line": 503, + "section": "Backslash escapes" + }, + { + "markdown": "\\*not emphasized*\n\\
not a tag\n\\[not a link](/foo)\n\\`not code`\n1\\. not a list\n\\* not a list\n\\# not a heading\n\\[foo]: /url \"not a reference\"\n\\ö not a character entity\n", + "html": "

*not emphasized*\n<br/> not a tag\n[not a link](/foo)\n`not code`\n1. not a list\n* not a list\n# not a heading\n[foo]: /url "not a reference"\n&ouml; not a character entity

\n", + "example": 14, + "start_line": 509, + "end_line": 529, + "section": "Backslash escapes" + }, + { + "markdown": "\\\\*emphasis*\n", + "html": "

\\emphasis

\n", + "example": 15, + "start_line": 534, + "end_line": 538, + "section": "Backslash escapes" + }, + { + "markdown": "foo\\\nbar\n", + "html": "

foo
\nbar

\n", + "example": 16, + "start_line": 543, + "end_line": 549, + "section": "Backslash escapes" + }, + { + "markdown": "`` \\[\\` ``\n", + "html": "

\\[\\`

\n", + "example": 17, + "start_line": 555, + "end_line": 559, + "section": "Backslash escapes" + }, + { + "markdown": " \\[\\]\n", + "html": "
\\[\\]\n
\n", + "example": 18, + "start_line": 562, + "end_line": 567, + "section": "Backslash escapes" + }, + { + "markdown": "~~~\n\\[\\]\n~~~\n", + "html": "
\\[\\]\n
\n", + "example": 19, + "start_line": 570, + "end_line": 577, + "section": "Backslash escapes" + }, + { + "markdown": "\n", + "html": "

https://example.com?find=\\*

\n", + "example": 20, + "start_line": 580, + "end_line": 584, + "section": "Backslash escapes" + }, + { + "markdown": "\n", + "html": "\n", + "example": 21, + "start_line": 587, + "end_line": 591, + "section": "Backslash escapes" + }, + { + "markdown": "[foo](/bar\\* \"ti\\*tle\")\n", + "html": "

foo

\n", + "example": 22, + "start_line": 597, + "end_line": 601, + "section": "Backslash escapes" + }, + { + "markdown": "[foo]\n\n[foo]: /bar\\* \"ti\\*tle\"\n", + "html": "

foo

\n", + "example": 23, + "start_line": 604, + "end_line": 610, + "section": "Backslash escapes" + }, + { + "markdown": "``` foo\\+bar\nfoo\n```\n", + "html": "
foo\n
\n", + "example": 24, + "start_line": 613, + "end_line": 620, + "section": "Backslash escapes" + }, + { + "markdown": "  & © Æ Ď\n¾ ℋ ⅆ\n∲ ≧̸\n", + "html": "

  & © Æ Ď\n¾ ℋ ⅆ\n∲ ≧̸

\n", + "example": 25, + "start_line": 649, + "end_line": 657, + "section": "Entity and numeric character references" + }, + { + "markdown": "# Ӓ Ϡ �\n", + "html": "

# Ӓ Ϡ �

\n", + "example": 26, + "start_line": 668, + "end_line": 672, + "section": "Entity and numeric character references" + }, + { + "markdown": "" ആ ಫ\n", + "html": "

" ആ ಫ

\n", + "example": 27, + "start_line": 681, + "end_line": 685, + "section": "Entity and numeric character references" + }, + { + "markdown": "  &x; &#; &#x;\n�\n&#abcdef0;\n&ThisIsNotDefined; &hi?;\n", + "html": "

&nbsp &x; &#; &#x;\n&#87654321;\n&#abcdef0;\n&ThisIsNotDefined; &hi?;

\n", + "example": 28, + "start_line": 690, + "end_line": 700, + "section": "Entity and numeric character references" + }, + { + "markdown": "©\n", + "html": "

&copy

\n", + "example": 29, + "start_line": 707, + "end_line": 711, + "section": "Entity and numeric character references" + }, + { + "markdown": "&MadeUpEntity;\n", + "html": "

&MadeUpEntity;

\n", + "example": 30, + "start_line": 717, + "end_line": 721, + "section": "Entity and numeric character references" + }, + { + "markdown": "\n", + "html": "\n", + "example": 31, + "start_line": 728, + "end_line": 732, + "section": "Entity and numeric character references" + }, + { + "markdown": "[foo](/föö \"föö\")\n", + "html": "

foo

\n", + "example": 32, + "start_line": 735, + "end_line": 739, + "section": "Entity and numeric character references" + }, + { + "markdown": "[foo]\n\n[foo]: /föö \"föö\"\n", + "html": "

foo

\n", + "example": 33, + "start_line": 742, + "end_line": 748, + "section": "Entity and numeric character references" + }, + { + "markdown": "``` föö\nfoo\n```\n", + "html": "
foo\n
\n", + "example": 34, + "start_line": 751, + "end_line": 758, + "section": "Entity and numeric character references" + }, + { + "markdown": "`föö`\n", + "html": "

f&ouml;&ouml;

\n", + "example": 35, + "start_line": 764, + "end_line": 768, + "section": "Entity and numeric character references" + }, + { + "markdown": " föfö\n", + "html": "
f&ouml;f&ouml;\n
\n", + "example": 36, + "start_line": 771, + "end_line": 776, + "section": "Entity and numeric character references" + }, + { + "markdown": "*foo*\n*foo*\n", + "html": "

*foo*\nfoo

\n", + "example": 37, + "start_line": 783, + "end_line": 789, + "section": "Entity and numeric character references" + }, + { + "markdown": "* foo\n\n* foo\n", + "html": "

* foo

\n
    \n
  • foo
  • \n
\n", + "example": 38, + "start_line": 791, + "end_line": 800, + "section": "Entity and numeric character references" + }, + { + "markdown": "foo bar\n", + "html": "

foo\n\nbar

\n", + "example": 39, + "start_line": 802, + "end_line": 808, + "section": "Entity and numeric character references" + }, + { + "markdown": " foo\n", + "html": "

\tfoo

\n", + "example": 40, + "start_line": 810, + "end_line": 814, + "section": "Entity and numeric character references" + }, + { + "markdown": "[a](url "tit")\n", + "html": "

[a](url "tit")

\n", + "example": 41, + "start_line": 817, + "end_line": 821, + "section": "Entity and numeric character references" + }, + { + "markdown": "- `one\n- two`\n", + "html": "
    \n
  • `one
  • \n
  • two`
  • \n
\n", + "example": 42, + "start_line": 840, + "end_line": 848, + "section": "Precedence" + }, + { + "markdown": "***\n---\n___\n", + "html": "
\n
\n
\n", + "example": 43, + "start_line": 879, + "end_line": 887, + "section": "Thematic breaks" + }, + { + "markdown": "+++\n", + "html": "

+++

\n", + "example": 44, + "start_line": 892, + "end_line": 896, + "section": "Thematic breaks" + }, + { + "markdown": "===\n", + "html": "

===

\n", + "example": 45, + "start_line": 899, + "end_line": 903, + "section": "Thematic breaks" + }, + { + "markdown": "--\n**\n__\n", + "html": "

--\n**\n__

\n", + "example": 46, + "start_line": 908, + "end_line": 916, + "section": "Thematic breaks" + }, + { + "markdown": " ***\n ***\n ***\n", + "html": "
\n
\n
\n", + "example": 47, + "start_line": 921, + "end_line": 929, + "section": "Thematic breaks" + }, + { + "markdown": " ***\n", + "html": "
***\n
\n", + "example": 48, + "start_line": 934, + "end_line": 939, + "section": "Thematic breaks" + }, + { + "markdown": "Foo\n ***\n", + "html": "

Foo\n***

\n", + "example": 49, + "start_line": 942, + "end_line": 948, + "section": "Thematic breaks" + }, + { + "markdown": "_____________________________________\n", + "html": "
\n", + "example": 50, + "start_line": 953, + "end_line": 957, + "section": "Thematic breaks" + }, + { + "markdown": " - - -\n", + "html": "
\n", + "example": 51, + "start_line": 962, + "end_line": 966, + "section": "Thematic breaks" + }, + { + "markdown": " ** * ** * ** * **\n", + "html": "
\n", + "example": 52, + "start_line": 969, + "end_line": 973, + "section": "Thematic breaks" + }, + { + "markdown": "- - - -\n", + "html": "
\n", + "example": 53, + "start_line": 976, + "end_line": 980, + "section": "Thematic breaks" + }, + { + "markdown": "- - - - \n", + "html": "
\n", + "example": 54, + "start_line": 985, + "end_line": 989, + "section": "Thematic breaks" + }, + { + "markdown": "_ _ _ _ a\n\na------\n\n---a---\n", + "html": "

_ _ _ _ a

\n

a------

\n

---a---

\n", + "example": 55, + "start_line": 994, + "end_line": 1004, + "section": "Thematic breaks" + }, + { + "markdown": " *-*\n", + "html": "

-

\n", + "example": 56, + "start_line": 1010, + "end_line": 1014, + "section": "Thematic breaks" + }, + { + "markdown": "- foo\n***\n- bar\n", + "html": "
    \n
  • foo
  • \n
\n
\n
    \n
  • bar
  • \n
\n", + "example": 57, + "start_line": 1019, + "end_line": 1031, + "section": "Thematic breaks" + }, + { + "markdown": "Foo\n***\nbar\n", + "html": "

Foo

\n
\n

bar

\n", + "example": 58, + "start_line": 1036, + "end_line": 1044, + "section": "Thematic breaks" + }, + { + "markdown": "Foo\n---\nbar\n", + "html": "

Foo

\n

bar

\n", + "example": 59, + "start_line": 1053, + "end_line": 1060, + "section": "Thematic breaks" + }, + { + "markdown": "* Foo\n* * *\n* Bar\n", + "html": "
    \n
  • Foo
  • \n
\n
\n
    \n
  • Bar
  • \n
\n", + "example": 60, + "start_line": 1066, + "end_line": 1078, + "section": "Thematic breaks" + }, + { + "markdown": "- Foo\n- * * *\n", + "html": "
    \n
  • Foo
  • \n
  • \n
    \n
  • \n
\n", + "example": 61, + "start_line": 1083, + "end_line": 1093, + "section": "Thematic breaks" + }, + { + "markdown": "# foo\n## foo\n### foo\n#### foo\n##### foo\n###### foo\n", + "html": "

foo

\n

foo

\n

foo

\n

foo

\n
foo
\n
foo
\n", + "example": 62, + "start_line": 1112, + "end_line": 1126, + "section": "ATX headings" + }, + { + "markdown": "####### foo\n", + "html": "

####### foo

\n", + "example": 63, + "start_line": 1131, + "end_line": 1135, + "section": "ATX headings" + }, + { + "markdown": "#5 bolt\n\n#hashtag\n", + "html": "

#5 bolt

\n

#hashtag

\n", + "example": 64, + "start_line": 1146, + "end_line": 1153, + "section": "ATX headings" + }, + { + "markdown": "\\## foo\n", + "html": "

## foo

\n", + "example": 65, + "start_line": 1158, + "end_line": 1162, + "section": "ATX headings" + }, + { + "markdown": "# foo *bar* \\*baz\\*\n", + "html": "

foo bar *baz*

\n", + "example": 66, + "start_line": 1167, + "end_line": 1171, + "section": "ATX headings" + }, + { + "markdown": "# foo \n", + "html": "

foo

\n", + "example": 67, + "start_line": 1176, + "end_line": 1180, + "section": "ATX headings" + }, + { + "markdown": " ### foo\n ## foo\n # foo\n", + "html": "

foo

\n

foo

\n

foo

\n", + "example": 68, + "start_line": 1185, + "end_line": 1193, + "section": "ATX headings" + }, + { + "markdown": " # foo\n", + "html": "
# foo\n
\n", + "example": 69, + "start_line": 1198, + "end_line": 1203, + "section": "ATX headings" + }, + { + "markdown": "foo\n # bar\n", + "html": "

foo\n# bar

\n", + "example": 70, + "start_line": 1206, + "end_line": 1212, + "section": "ATX headings" + }, + { + "markdown": "## foo ##\n ### bar ###\n", + "html": "

foo

\n

bar

\n", + "example": 71, + "start_line": 1217, + "end_line": 1223, + "section": "ATX headings" + }, + { + "markdown": "# foo ##################################\n##### foo ##\n", + "html": "

foo

\n
foo
\n", + "example": 72, + "start_line": 1228, + "end_line": 1234, + "section": "ATX headings" + }, + { + "markdown": "### foo ### \n", + "html": "

foo

\n", + "example": 73, + "start_line": 1239, + "end_line": 1243, + "section": "ATX headings" + }, + { + "markdown": "### foo ### b\n", + "html": "

foo ### b

\n", + "example": 74, + "start_line": 1250, + "end_line": 1254, + "section": "ATX headings" + }, + { + "markdown": "# foo#\n", + "html": "

foo#

\n", + "example": 75, + "start_line": 1259, + "end_line": 1263, + "section": "ATX headings" + }, + { + "markdown": "### foo \\###\n## foo #\\##\n# foo \\#\n", + "html": "

foo ###

\n

foo ###

\n

foo #

\n", + "example": 76, + "start_line": 1269, + "end_line": 1277, + "section": "ATX headings" + }, + { + "markdown": "****\n## foo\n****\n", + "html": "
\n

foo

\n
\n", + "example": 77, + "start_line": 1283, + "end_line": 1291, + "section": "ATX headings" + }, + { + "markdown": "Foo bar\n# baz\nBar foo\n", + "html": "

Foo bar

\n

baz

\n

Bar foo

\n", + "example": 78, + "start_line": 1294, + "end_line": 1302, + "section": "ATX headings" + }, + { + "markdown": "## \n#\n### ###\n", + "html": "

\n

\n

\n", + "example": 79, + "start_line": 1307, + "end_line": 1315, + "section": "ATX headings" + }, + { + "markdown": "Foo *bar*\n=========\n\nFoo *bar*\n---------\n", + "html": "

Foo bar

\n

Foo bar

\n", + "example": 80, + "start_line": 1347, + "end_line": 1356, + "section": "Setext headings" + }, + { + "markdown": "Foo *bar\nbaz*\n====\n", + "html": "

Foo bar\nbaz

\n", + "example": 81, + "start_line": 1361, + "end_line": 1368, + "section": "Setext headings" + }, + { + "markdown": " Foo *bar\nbaz*\t\n====\n", + "html": "

Foo bar\nbaz

\n", + "example": 82, + "start_line": 1375, + "end_line": 1382, + "section": "Setext headings" + }, + { + "markdown": "Foo\n-------------------------\n\nFoo\n=\n", + "html": "

Foo

\n

Foo

\n", + "example": 83, + "start_line": 1387, + "end_line": 1396, + "section": "Setext headings" + }, + { + "markdown": " Foo\n---\n\n Foo\n-----\n\n Foo\n ===\n", + "html": "

Foo

\n

Foo

\n

Foo

\n", + "example": 84, + "start_line": 1402, + "end_line": 1415, + "section": "Setext headings" + }, + { + "markdown": " Foo\n ---\n\n Foo\n---\n", + "html": "
Foo\n---\n\nFoo\n
\n
\n", + "example": 85, + "start_line": 1420, + "end_line": 1433, + "section": "Setext headings" + }, + { + "markdown": "Foo\n ---- \n", + "html": "

Foo

\n", + "example": 86, + "start_line": 1439, + "end_line": 1444, + "section": "Setext headings" + }, + { + "markdown": "Foo\n ---\n", + "html": "

Foo\n---

\n", + "example": 87, + "start_line": 1449, + "end_line": 1455, + "section": "Setext headings" + }, + { + "markdown": "Foo\n= =\n\nFoo\n--- -\n", + "html": "

Foo\n= =

\n

Foo

\n
\n", + "example": 88, + "start_line": 1460, + "end_line": 1471, + "section": "Setext headings" + }, + { + "markdown": "Foo \n-----\n", + "html": "

Foo

\n", + "example": 89, + "start_line": 1476, + "end_line": 1481, + "section": "Setext headings" + }, + { + "markdown": "Foo\\\n----\n", + "html": "

Foo\\

\n", + "example": 90, + "start_line": 1486, + "end_line": 1491, + "section": "Setext headings" + }, + { + "markdown": "`Foo\n----\n`\n\n\n", + "html": "

`Foo

\n

`

\n

<a title="a lot

\n

of dashes"/>

\n", + "example": 91, + "start_line": 1497, + "end_line": 1510, + "section": "Setext headings" + }, + { + "markdown": "> Foo\n---\n", + "html": "
\n

Foo

\n
\n
\n", + "example": 92, + "start_line": 1516, + "end_line": 1524, + "section": "Setext headings" + }, + { + "markdown": "> foo\nbar\n===\n", + "html": "
\n

foo\nbar\n===

\n
\n", + "example": 93, + "start_line": 1527, + "end_line": 1537, + "section": "Setext headings" + }, + { + "markdown": "- Foo\n---\n", + "html": "
    \n
  • Foo
  • \n
\n
\n", + "example": 94, + "start_line": 1540, + "end_line": 1548, + "section": "Setext headings" + }, + { + "markdown": "Foo\nBar\n---\n", + "html": "

Foo\nBar

\n", + "example": 95, + "start_line": 1555, + "end_line": 1562, + "section": "Setext headings" + }, + { + "markdown": "---\nFoo\n---\nBar\n---\nBaz\n", + "html": "
\n

Foo

\n

Bar

\n

Baz

\n", + "example": 96, + "start_line": 1568, + "end_line": 1580, + "section": "Setext headings" + }, + { + "markdown": "\n====\n", + "html": "

====

\n", + "example": 97, + "start_line": 1585, + "end_line": 1590, + "section": "Setext headings" + }, + { + "markdown": "---\n---\n", + "html": "
\n
\n", + "example": 98, + "start_line": 1597, + "end_line": 1603, + "section": "Setext headings" + }, + { + "markdown": "- foo\n-----\n", + "html": "
    \n
  • foo
  • \n
\n
\n", + "example": 99, + "start_line": 1606, + "end_line": 1614, + "section": "Setext headings" + }, + { + "markdown": " foo\n---\n", + "html": "
foo\n
\n
\n", + "example": 100, + "start_line": 1617, + "end_line": 1624, + "section": "Setext headings" + }, + { + "markdown": "> foo\n-----\n", + "html": "
\n

foo

\n
\n
\n", + "example": 101, + "start_line": 1627, + "end_line": 1635, + "section": "Setext headings" + }, + { + "markdown": "\\> foo\n------\n", + "html": "

> foo

\n", + "example": 102, + "start_line": 1641, + "end_line": 1646, + "section": "Setext headings" + }, + { + "markdown": "Foo\n\nbar\n---\nbaz\n", + "html": "

Foo

\n

bar

\n

baz

\n", + "example": 103, + "start_line": 1672, + "end_line": 1682, + "section": "Setext headings" + }, + { + "markdown": "Foo\nbar\n\n---\n\nbaz\n", + "html": "

Foo\nbar

\n
\n

baz

\n", + "example": 104, + "start_line": 1688, + "end_line": 1700, + "section": "Setext headings" + }, + { + "markdown": "Foo\nbar\n* * *\nbaz\n", + "html": "

Foo\nbar

\n
\n

baz

\n", + "example": 105, + "start_line": 1706, + "end_line": 1716, + "section": "Setext headings" + }, + { + "markdown": "Foo\nbar\n\\---\nbaz\n", + "html": "

Foo\nbar\n---\nbaz

\n", + "example": 106, + "start_line": 1721, + "end_line": 1731, + "section": "Setext headings" + }, + { + "markdown": " a simple\n indented code block\n", + "html": "
a simple\n  indented code block\n
\n", + "example": 107, + "start_line": 1749, + "end_line": 1756, + "section": "Indented code blocks" + }, + { + "markdown": " - foo\n\n bar\n", + "html": "
    \n
  • \n

    foo

    \n

    bar

    \n
  • \n
\n", + "example": 108, + "start_line": 1763, + "end_line": 1774, + "section": "Indented code blocks" + }, + { + "markdown": "1. foo\n\n - bar\n", + "html": "
    \n
  1. \n

    foo

    \n
      \n
    • bar
    • \n
    \n
  2. \n
\n", + "example": 109, + "start_line": 1777, + "end_line": 1790, + "section": "Indented code blocks" + }, + { + "markdown": "
\n *hi*\n\n - one\n", + "html": "
<a/>\n*hi*\n\n- one\n
\n", + "example": 110, + "start_line": 1797, + "end_line": 1808, + "section": "Indented code blocks" + }, + { + "markdown": " chunk1\n\n chunk2\n \n \n \n chunk3\n", + "html": "
chunk1\n\nchunk2\n\n\n\nchunk3\n
\n", + "example": 111, + "start_line": 1813, + "end_line": 1830, + "section": "Indented code blocks" + }, + { + "markdown": " chunk1\n \n chunk2\n", + "html": "
chunk1\n  \n  chunk2\n
\n", + "example": 112, + "start_line": 1836, + "end_line": 1845, + "section": "Indented code blocks" + }, + { + "markdown": "Foo\n bar\n\n", + "html": "

Foo\nbar

\n", + "example": 113, + "start_line": 1851, + "end_line": 1858, + "section": "Indented code blocks" + }, + { + "markdown": " foo\nbar\n", + "html": "
foo\n
\n

bar

\n", + "example": 114, + "start_line": 1865, + "end_line": 1872, + "section": "Indented code blocks" + }, + { + "markdown": "# Heading\n foo\nHeading\n------\n foo\n----\n", + "html": "

Heading

\n
foo\n
\n

Heading

\n
foo\n
\n
\n", + "example": 115, + "start_line": 1878, + "end_line": 1893, + "section": "Indented code blocks" + }, + { + "markdown": " foo\n bar\n", + "html": "
    foo\nbar\n
\n", + "example": 116, + "start_line": 1898, + "end_line": 1905, + "section": "Indented code blocks" + }, + { + "markdown": "\n \n foo\n \n\n", + "html": "
foo\n
\n", + "example": 117, + "start_line": 1911, + "end_line": 1920, + "section": "Indented code blocks" + }, + { + "markdown": " foo \n", + "html": "
foo  \n
\n", + "example": 118, + "start_line": 1925, + "end_line": 1930, + "section": "Indented code blocks" + }, + { + "markdown": "```\n<\n >\n```\n", + "html": "
<\n >\n
\n", + "example": 119, + "start_line": 1980, + "end_line": 1989, + "section": "Fenced code blocks" + }, + { + "markdown": "~~~\n<\n >\n~~~\n", + "html": "
<\n >\n
\n", + "example": 120, + "start_line": 1994, + "end_line": 2003, + "section": "Fenced code blocks" + }, + { + "markdown": "``\nfoo\n``\n", + "html": "

foo

\n", + "example": 121, + "start_line": 2007, + "end_line": 2013, + "section": "Fenced code blocks" + }, + { + "markdown": "```\naaa\n~~~\n```\n", + "html": "
aaa\n~~~\n
\n", + "example": 122, + "start_line": 2018, + "end_line": 2027, + "section": "Fenced code blocks" + }, + { + "markdown": "~~~\naaa\n```\n~~~\n", + "html": "
aaa\n```\n
\n", + "example": 123, + "start_line": 2030, + "end_line": 2039, + "section": "Fenced code blocks" + }, + { + "markdown": "````\naaa\n```\n``````\n", + "html": "
aaa\n```\n
\n", + "example": 124, + "start_line": 2044, + "end_line": 2053, + "section": "Fenced code blocks" + }, + { + "markdown": "~~~~\naaa\n~~~\n~~~~\n", + "html": "
aaa\n~~~\n
\n", + "example": 125, + "start_line": 2056, + "end_line": 2065, + "section": "Fenced code blocks" + }, + { + "markdown": "```\n", + "html": "
\n", + "example": 126, + "start_line": 2071, + "end_line": 2075, + "section": "Fenced code blocks" + }, + { + "markdown": "`````\n\n```\naaa\n", + "html": "
\n```\naaa\n
\n", + "example": 127, + "start_line": 2078, + "end_line": 2088, + "section": "Fenced code blocks" + }, + { + "markdown": "> ```\n> aaa\n\nbbb\n", + "html": "
\n
aaa\n
\n
\n

bbb

\n", + "example": 128, + "start_line": 2091, + "end_line": 2102, + "section": "Fenced code blocks" + }, + { + "markdown": "```\n\n \n```\n", + "html": "
\n  \n
\n", + "example": 129, + "start_line": 2107, + "end_line": 2116, + "section": "Fenced code blocks" + }, + { + "markdown": "```\n```\n", + "html": "
\n", + "example": 130, + "start_line": 2121, + "end_line": 2126, + "section": "Fenced code blocks" + }, + { + "markdown": " ```\n aaa\naaa\n```\n", + "html": "
aaa\naaa\n
\n", + "example": 131, + "start_line": 2133, + "end_line": 2142, + "section": "Fenced code blocks" + }, + { + "markdown": " ```\naaa\n aaa\naaa\n ```\n", + "html": "
aaa\naaa\naaa\n
\n", + "example": 132, + "start_line": 2145, + "end_line": 2156, + "section": "Fenced code blocks" + }, + { + "markdown": " ```\n aaa\n aaa\n aaa\n ```\n", + "html": "
aaa\n aaa\naaa\n
\n", + "example": 133, + "start_line": 2159, + "end_line": 2170, + "section": "Fenced code blocks" + }, + { + "markdown": " ```\n aaa\n ```\n", + "html": "
```\naaa\n```\n
\n", + "example": 134, + "start_line": 2175, + "end_line": 2184, + "section": "Fenced code blocks" + }, + { + "markdown": "```\naaa\n ```\n", + "html": "
aaa\n
\n", + "example": 135, + "start_line": 2190, + "end_line": 2197, + "section": "Fenced code blocks" + }, + { + "markdown": " ```\naaa\n ```\n", + "html": "
aaa\n
\n", + "example": 136, + "start_line": 2200, + "end_line": 2207, + "section": "Fenced code blocks" + }, + { + "markdown": "```\naaa\n ```\n", + "html": "
aaa\n    ```\n
\n", + "example": 137, + "start_line": 2212, + "end_line": 2220, + "section": "Fenced code blocks" + }, + { + "markdown": "``` ```\naaa\n", + "html": "

\naaa

\n", + "example": 138, + "start_line": 2226, + "end_line": 2232, + "section": "Fenced code blocks" + }, + { + "markdown": "~~~~~~\naaa\n~~~ ~~\n", + "html": "
aaa\n~~~ ~~\n
\n", + "example": 139, + "start_line": 2235, + "end_line": 2243, + "section": "Fenced code blocks" + }, + { + "markdown": "foo\n```\nbar\n```\nbaz\n", + "html": "

foo

\n
bar\n
\n

baz

\n", + "example": 140, + "start_line": 2249, + "end_line": 2260, + "section": "Fenced code blocks" + }, + { + "markdown": "foo\n---\n~~~\nbar\n~~~\n# baz\n", + "html": "

foo

\n
bar\n
\n

baz

\n", + "example": 141, + "start_line": 2266, + "end_line": 2278, + "section": "Fenced code blocks" + }, + { + "markdown": "```ruby\ndef foo(x)\n return 3\nend\n```\n", + "html": "
def foo(x)\n  return 3\nend\n
\n", + "example": 142, + "start_line": 2288, + "end_line": 2299, + "section": "Fenced code blocks" + }, + { + "markdown": "~~~~ ruby startline=3 $%@#$\ndef foo(x)\n return 3\nend\n~~~~~~~\n", + "html": "
def foo(x)\n  return 3\nend\n
\n", + "example": 143, + "start_line": 2302, + "end_line": 2313, + "section": "Fenced code blocks" + }, + { + "markdown": "````;\n````\n", + "html": "
\n", + "example": 144, + "start_line": 2316, + "end_line": 2321, + "section": "Fenced code blocks" + }, + { + "markdown": "``` aa ```\nfoo\n", + "html": "

aa\nfoo

\n", + "example": 145, + "start_line": 2326, + "end_line": 2332, + "section": "Fenced code blocks" + }, + { + "markdown": "~~~ aa ``` ~~~\nfoo\n~~~\n", + "html": "
foo\n
\n", + "example": 146, + "start_line": 2337, + "end_line": 2344, + "section": "Fenced code blocks" + }, + { + "markdown": "```\n``` aaa\n```\n", + "html": "
``` aaa\n
\n", + "example": 147, + "start_line": 2349, + "end_line": 2356, + "section": "Fenced code blocks" + }, + { + "markdown": "
\n
\n**Hello**,\n\n_world_.\n
\n
\n", + "html": "
\n
\n**Hello**,\n

world.\n

\n
\n", + "example": 148, + "start_line": 2428, + "end_line": 2443, + "section": "HTML blocks" + }, + { + "markdown": "\n \n \n \n
\n hi\n
\n\nokay.\n", + "html": "\n \n \n \n
\n hi\n
\n

okay.

\n", + "example": 149, + "start_line": 2457, + "end_line": 2476, + "section": "HTML blocks" + }, + { + "markdown": "
\n*foo*\n", + "example": 151, + "start_line": 2492, + "end_line": 2498, + "section": "HTML blocks" + }, + { + "markdown": "
\n\n*Markdown*\n\n
\n", + "html": "
\n

Markdown

\n
\n", + "example": 152, + "start_line": 2503, + "end_line": 2513, + "section": "HTML blocks" + }, + { + "markdown": "
\n
\n", + "html": "
\n
\n", + "example": 153, + "start_line": 2519, + "end_line": 2527, + "section": "HTML blocks" + }, + { + "markdown": "
\n
\n", + "html": "
\n
\n", + "example": 154, + "start_line": 2530, + "end_line": 2538, + "section": "HTML blocks" + }, + { + "markdown": "
\n*foo*\n\n*bar*\n", + "html": "
\n*foo*\n

bar

\n", + "example": 155, + "start_line": 2542, + "end_line": 2551, + "section": "HTML blocks" + }, + { + "markdown": "
\n", + "html": "\n", + "example": 159, + "start_line": 2591, + "end_line": 2595, + "section": "HTML blocks" + }, + { + "markdown": "
\nfoo\n
\n", + "html": "
\nfoo\n
\n", + "example": 160, + "start_line": 2598, + "end_line": 2606, + "section": "HTML blocks" + }, + { + "markdown": "
\n``` c\nint x = 33;\n```\n", + "html": "
\n``` c\nint x = 33;\n```\n", + "example": 161, + "start_line": 2615, + "end_line": 2625, + "section": "HTML blocks" + }, + { + "markdown": "\n*bar*\n\n", + "html": "\n*bar*\n\n", + "example": 162, + "start_line": 2632, + "end_line": 2640, + "section": "HTML blocks" + }, + { + "markdown": "\n*bar*\n\n", + "html": "\n*bar*\n\n", + "example": 163, + "start_line": 2645, + "end_line": 2653, + "section": "HTML blocks" + }, + { + "markdown": "\n*bar*\n\n", + "html": "\n*bar*\n\n", + "example": 164, + "start_line": 2656, + "end_line": 2664, + "section": "HTML blocks" + }, + { + "markdown": "\n*bar*\n", + "html": "\n*bar*\n", + "example": 165, + "start_line": 2667, + "end_line": 2673, + "section": "HTML blocks" + }, + { + "markdown": "\n*foo*\n\n", + "html": "\n*foo*\n\n", + "example": 166, + "start_line": 2682, + "end_line": 2690, + "section": "HTML blocks" + }, + { + "markdown": "\n\n*foo*\n\n\n", + "html": "\n

foo

\n
\n", + "example": 167, + "start_line": 2697, + "end_line": 2707, + "section": "HTML blocks" + }, + { + "markdown": "*foo*\n", + "html": "

foo

\n", + "example": 168, + "start_line": 2715, + "end_line": 2719, + "section": "HTML blocks" + }, + { + "markdown": "
\nimport Text.HTML.TagSoup\n\nmain :: IO ()\nmain = print $ parseTags tags\n
\nokay\n", + "html": "
\nimport Text.HTML.TagSoup\n\nmain :: IO ()\nmain = print $ parseTags tags\n
\n

okay

\n", + "example": 169, + "start_line": 2731, + "end_line": 2747, + "section": "HTML blocks" + }, + { + "markdown": "\nokay\n", + "html": "\n

okay

\n", + "example": 170, + "start_line": 2752, + "end_line": 2766, + "section": "HTML blocks" + }, + { + "markdown": "\n", + "html": "\n", + "example": 171, + "start_line": 2771, + "end_line": 2787, + "section": "HTML blocks" + }, + { + "markdown": "\nh1 {color:red;}\n\np {color:blue;}\n\nokay\n", + "html": "\nh1 {color:red;}\n\np {color:blue;}\n\n

okay

\n", + "example": 172, + "start_line": 2791, + "end_line": 2807, + "section": "HTML blocks" + }, + { + "markdown": "\n\nfoo\n", + "html": "\n\nfoo\n", + "example": 173, + "start_line": 2814, + "end_line": 2824, + "section": "HTML blocks" + }, + { + "markdown": ">
\n> foo\n\nbar\n", + "html": "
\n
\nfoo\n
\n

bar

\n", + "example": 174, + "start_line": 2827, + "end_line": 2838, + "section": "HTML blocks" + }, + { + "markdown": "-
\n- foo\n", + "html": "
    \n
  • \n
    \n
  • \n
  • foo
  • \n
\n", + "example": 175, + "start_line": 2841, + "end_line": 2851, + "section": "HTML blocks" + }, + { + "markdown": "\n*foo*\n", + "html": "\n

foo

\n", + "example": 176, + "start_line": 2856, + "end_line": 2862, + "section": "HTML blocks" + }, + { + "markdown": "*bar*\n*baz*\n", + "html": "*bar*\n

baz

\n", + "example": 177, + "start_line": 2865, + "end_line": 2871, + "section": "HTML blocks" + }, + { + "markdown": "1. *bar*\n", + "html": "1. *bar*\n", + "example": 178, + "start_line": 2877, + "end_line": 2885, + "section": "HTML blocks" + }, + { + "markdown": "\nokay\n", + "html": "\n

okay

\n", + "example": 179, + "start_line": 2890, + "end_line": 2902, + "section": "HTML blocks" + }, + { + "markdown": "';\n\n?>\nokay\n", + "html": "';\n\n?>\n

okay

\n", + "example": 180, + "start_line": 2908, + "end_line": 2922, + "section": "HTML blocks" + }, + { + "markdown": "\n", + "html": "\n", + "example": 181, + "start_line": 2927, + "end_line": 2931, + "section": "HTML blocks" + }, + { + "markdown": "\nokay\n", + "html": "\n

okay

\n", + "example": 182, + "start_line": 2936, + "end_line": 2964, + "section": "HTML blocks" + }, + { + "markdown": " \n\n \n", + "html": " \n
<!-- foo -->\n
\n", + "example": 183, + "start_line": 2970, + "end_line": 2978, + "section": "HTML blocks" + }, + { + "markdown": "
\n\n
\n", + "html": "
\n
<div>\n
\n", + "example": 184, + "start_line": 2981, + "end_line": 2989, + "section": "HTML blocks" + }, + { + "markdown": "Foo\n
\nbar\n
\n", + "html": "

Foo

\n
\nbar\n
\n", + "example": 185, + "start_line": 2995, + "end_line": 3005, + "section": "HTML blocks" + }, + { + "markdown": "
\nbar\n
\n*foo*\n", + "html": "
\nbar\n
\n*foo*\n", + "example": 186, + "start_line": 3012, + "end_line": 3022, + "section": "HTML blocks" + }, + { + "markdown": "Foo\n\nbaz\n", + "html": "

Foo\n\nbaz

\n", + "example": 187, + "start_line": 3027, + "end_line": 3035, + "section": "HTML blocks" + }, + { + "markdown": "
\n\n*Emphasized* text.\n\n
\n", + "html": "
\n

Emphasized text.

\n
\n", + "example": 188, + "start_line": 3068, + "end_line": 3078, + "section": "HTML blocks" + }, + { + "markdown": "
\n*Emphasized* text.\n
\n", + "html": "
\n*Emphasized* text.\n
\n", + "example": 189, + "start_line": 3081, + "end_line": 3089, + "section": "HTML blocks" + }, + { + "markdown": "\n\n\n\n\n\n\n\n
\nHi\n
\n", + "html": "\n\n\n\n
\nHi\n
\n", + "example": 190, + "start_line": 3103, + "end_line": 3123, + "section": "HTML blocks" + }, + { + "markdown": "\n\n \n\n \n\n \n\n
\n Hi\n
\n", + "html": "\n \n
<td>\n  Hi\n</td>\n
\n \n
\n", + "example": 191, + "start_line": 3130, + "end_line": 3151, + "section": "HTML blocks" + }, + { + "markdown": "[foo]: /url \"title\"\n\n[foo]\n", + "html": "

foo

\n", + "example": 192, + "start_line": 3179, + "end_line": 3185, + "section": "Link reference definitions" + }, + { + "markdown": " [foo]: \n /url \n 'the title' \n\n[foo]\n", + "html": "

foo

\n", + "example": 193, + "start_line": 3188, + "end_line": 3196, + "section": "Link reference definitions" + }, + { + "markdown": "[Foo*bar\\]]:my_(url) 'title (with parens)'\n\n[Foo*bar\\]]\n", + "html": "

Foo*bar]

\n", + "example": 194, + "start_line": 3199, + "end_line": 3205, + "section": "Link reference definitions" + }, + { + "markdown": "[Foo bar]:\n\n'title'\n\n[Foo bar]\n", + "html": "

Foo bar

\n", + "example": 195, + "start_line": 3208, + "end_line": 3216, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /url '\ntitle\nline1\nline2\n'\n\n[foo]\n", + "html": "

foo

\n", + "example": 196, + "start_line": 3221, + "end_line": 3235, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /url 'title\n\nwith blank line'\n\n[foo]\n", + "html": "

[foo]: /url 'title

\n

with blank line'

\n

[foo]

\n", + "example": 197, + "start_line": 3240, + "end_line": 3250, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]:\n/url\n\n[foo]\n", + "html": "

foo

\n", + "example": 198, + "start_line": 3255, + "end_line": 3262, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]:\n\n[foo]\n", + "html": "

[foo]:

\n

[foo]

\n", + "example": 199, + "start_line": 3267, + "end_line": 3274, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: <>\n\n[foo]\n", + "html": "

foo

\n", + "example": 200, + "start_line": 3279, + "end_line": 3285, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: (baz)\n\n[foo]\n", + "html": "

[foo]: (baz)

\n

[foo]

\n", + "example": 201, + "start_line": 3290, + "end_line": 3297, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /url\\bar\\*baz \"foo\\\"bar\\baz\"\n\n[foo]\n", + "html": "

foo

\n", + "example": 202, + "start_line": 3303, + "end_line": 3309, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]\n\n[foo]: url\n", + "html": "

foo

\n", + "example": 203, + "start_line": 3314, + "end_line": 3320, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]\n\n[foo]: first\n[foo]: second\n", + "html": "

foo

\n", + "example": 204, + "start_line": 3326, + "end_line": 3333, + "section": "Link reference definitions" + }, + { + "markdown": "[FOO]: /url\n\n[Foo]\n", + "html": "

Foo

\n", + "example": 205, + "start_line": 3339, + "end_line": 3345, + "section": "Link reference definitions" + }, + { + "markdown": "[ΑΓΩ]: /φου\n\n[αγω]\n", + "html": "

αγω

\n", + "example": 206, + "start_line": 3348, + "end_line": 3354, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /url\n", + "html": "", + "example": 207, + "start_line": 3363, + "end_line": 3366, + "section": "Link reference definitions" + }, + { + "markdown": "[\nfoo\n]: /url\nbar\n", + "html": "

bar

\n", + "example": 208, + "start_line": 3371, + "end_line": 3378, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /url \"title\" ok\n", + "html": "

[foo]: /url "title" ok

\n", + "example": 209, + "start_line": 3384, + "end_line": 3388, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /url\n\"title\" ok\n", + "html": "

"title" ok

\n", + "example": 210, + "start_line": 3393, + "end_line": 3398, + "section": "Link reference definitions" + }, + { + "markdown": " [foo]: /url \"title\"\n\n[foo]\n", + "html": "
[foo]: /url "title"\n
\n

[foo]

\n", + "example": 211, + "start_line": 3404, + "end_line": 3412, + "section": "Link reference definitions" + }, + { + "markdown": "```\n[foo]: /url\n```\n\n[foo]\n", + "html": "
[foo]: /url\n
\n

[foo]

\n", + "example": 212, + "start_line": 3418, + "end_line": 3428, + "section": "Link reference definitions" + }, + { + "markdown": "Foo\n[bar]: /baz\n\n[bar]\n", + "html": "

Foo\n[bar]: /baz

\n

[bar]

\n", + "example": 213, + "start_line": 3433, + "end_line": 3442, + "section": "Link reference definitions" + }, + { + "markdown": "# [Foo]\n[foo]: /url\n> bar\n", + "html": "

Foo

\n
\n

bar

\n
\n", + "example": 214, + "start_line": 3448, + "end_line": 3457, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /url\nbar\n===\n[foo]\n", + "html": "

bar

\n

foo

\n", + "example": 215, + "start_line": 3459, + "end_line": 3467, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /url\n===\n[foo]\n", + "html": "

===\nfoo

\n", + "example": 216, + "start_line": 3469, + "end_line": 3476, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]: /foo-url \"foo\"\n[bar]: /bar-url\n \"bar\"\n[baz]: /baz-url\n\n[foo],\n[bar],\n[baz]\n", + "html": "

foo,\nbar,\nbaz

\n", + "example": 217, + "start_line": 3482, + "end_line": 3495, + "section": "Link reference definitions" + }, + { + "markdown": "[foo]\n\n> [foo]: /url\n", + "html": "

foo

\n
\n
\n", + "example": 218, + "start_line": 3503, + "end_line": 3511, + "section": "Link reference definitions" + }, + { + "markdown": "aaa\n\nbbb\n", + "html": "

aaa

\n

bbb

\n", + "example": 219, + "start_line": 3525, + "end_line": 3532, + "section": "Paragraphs" + }, + { + "markdown": "aaa\nbbb\n\nccc\nddd\n", + "html": "

aaa\nbbb

\n

ccc\nddd

\n", + "example": 220, + "start_line": 3537, + "end_line": 3548, + "section": "Paragraphs" + }, + { + "markdown": "aaa\n\n\nbbb\n", + "html": "

aaa

\n

bbb

\n", + "example": 221, + "start_line": 3553, + "end_line": 3561, + "section": "Paragraphs" + }, + { + "markdown": " aaa\n bbb\n", + "html": "

aaa\nbbb

\n", + "example": 222, + "start_line": 3566, + "end_line": 3572, + "section": "Paragraphs" + }, + { + "markdown": "aaa\n bbb\n ccc\n", + "html": "

aaa\nbbb\nccc

\n", + "example": 223, + "start_line": 3578, + "end_line": 3586, + "section": "Paragraphs" + }, + { + "markdown": " aaa\nbbb\n", + "html": "

aaa\nbbb

\n", + "example": 224, + "start_line": 3592, + "end_line": 3598, + "section": "Paragraphs" + }, + { + "markdown": " aaa\nbbb\n", + "html": "
aaa\n
\n

bbb

\n", + "example": 225, + "start_line": 3601, + "end_line": 3608, + "section": "Paragraphs" + }, + { + "markdown": "aaa \nbbb \n", + "html": "

aaa
\nbbb

\n", + "example": 226, + "start_line": 3615, + "end_line": 3621, + "section": "Paragraphs" + }, + { + "markdown": " \n\naaa\n \n\n# aaa\n\n \n", + "html": "

aaa

\n

aaa

\n", + "example": 227, + "start_line": 3632, + "end_line": 3644, + "section": "Blank lines" + }, + { + "markdown": "> # Foo\n> bar\n> baz\n", + "html": "
\n

Foo

\n

bar\nbaz

\n
\n", + "example": 228, + "start_line": 3700, + "end_line": 3710, + "section": "Block quotes" + }, + { + "markdown": "># Foo\n>bar\n> baz\n", + "html": "
\n

Foo

\n

bar\nbaz

\n
\n", + "example": 229, + "start_line": 3715, + "end_line": 3725, + "section": "Block quotes" + }, + { + "markdown": " > # Foo\n > bar\n > baz\n", + "html": "
\n

Foo

\n

bar\nbaz

\n
\n", + "example": 230, + "start_line": 3730, + "end_line": 3740, + "section": "Block quotes" + }, + { + "markdown": " > # Foo\n > bar\n > baz\n", + "html": "
> # Foo\n> bar\n> baz\n
\n", + "example": 231, + "start_line": 3745, + "end_line": 3754, + "section": "Block quotes" + }, + { + "markdown": "> # Foo\n> bar\nbaz\n", + "html": "
\n

Foo

\n

bar\nbaz

\n
\n", + "example": 232, + "start_line": 3760, + "end_line": 3770, + "section": "Block quotes" + }, + { + "markdown": "> bar\nbaz\n> foo\n", + "html": "
\n

bar\nbaz\nfoo

\n
\n", + "example": 233, + "start_line": 3776, + "end_line": 3786, + "section": "Block quotes" + }, + { + "markdown": "> foo\n---\n", + "html": "
\n

foo

\n
\n
\n", + "example": 234, + "start_line": 3800, + "end_line": 3808, + "section": "Block quotes" + }, + { + "markdown": "> - foo\n- bar\n", + "html": "
\n
    \n
  • foo
  • \n
\n
\n
    \n
  • bar
  • \n
\n", + "example": 235, + "start_line": 3820, + "end_line": 3832, + "section": "Block quotes" + }, + { + "markdown": "> foo\n bar\n", + "html": "
\n
foo\n
\n
\n
bar\n
\n", + "example": 236, + "start_line": 3838, + "end_line": 3848, + "section": "Block quotes" + }, + { + "markdown": "> ```\nfoo\n```\n", + "html": "
\n
\n
\n

foo

\n
\n", + "example": 237, + "start_line": 3851, + "end_line": 3861, + "section": "Block quotes" + }, + { + "markdown": "> foo\n - bar\n", + "html": "
\n

foo\n- bar

\n
\n", + "example": 238, + "start_line": 3867, + "end_line": 3875, + "section": "Block quotes" + }, + { + "markdown": ">\n", + "html": "
\n
\n", + "example": 239, + "start_line": 3891, + "end_line": 3896, + "section": "Block quotes" + }, + { + "markdown": ">\n> \n> \n", + "html": "
\n
\n", + "example": 240, + "start_line": 3899, + "end_line": 3906, + "section": "Block quotes" + }, + { + "markdown": ">\n> foo\n> \n", + "html": "
\n

foo

\n
\n", + "example": 241, + "start_line": 3911, + "end_line": 3919, + "section": "Block quotes" + }, + { + "markdown": "> foo\n\n> bar\n", + "html": "
\n

foo

\n
\n
\n

bar

\n
\n", + "example": 242, + "start_line": 3924, + "end_line": 3935, + "section": "Block quotes" + }, + { + "markdown": "> foo\n> bar\n", + "html": "
\n

foo\nbar

\n
\n", + "example": 243, + "start_line": 3946, + "end_line": 3954, + "section": "Block quotes" + }, + { + "markdown": "> foo\n>\n> bar\n", + "html": "
\n

foo

\n

bar

\n
\n", + "example": 244, + "start_line": 3959, + "end_line": 3968, + "section": "Block quotes" + }, + { + "markdown": "foo\n> bar\n", + "html": "

foo

\n
\n

bar

\n
\n", + "example": 245, + "start_line": 3973, + "end_line": 3981, + "section": "Block quotes" + }, + { + "markdown": "> aaa\n***\n> bbb\n", + "html": "
\n

aaa

\n
\n
\n
\n

bbb

\n
\n", + "example": 246, + "start_line": 3987, + "end_line": 3999, + "section": "Block quotes" + }, + { + "markdown": "> bar\nbaz\n", + "html": "
\n

bar\nbaz

\n
\n", + "example": 247, + "start_line": 4005, + "end_line": 4013, + "section": "Block quotes" + }, + { + "markdown": "> bar\n\nbaz\n", + "html": "
\n

bar

\n
\n

baz

\n", + "example": 248, + "start_line": 4016, + "end_line": 4025, + "section": "Block quotes" + }, + { + "markdown": "> bar\n>\nbaz\n", + "html": "
\n

bar

\n
\n

baz

\n", + "example": 249, + "start_line": 4028, + "end_line": 4037, + "section": "Block quotes" + }, + { + "markdown": "> > > foo\nbar\n", + "html": "
\n
\n
\n

foo\nbar

\n
\n
\n
\n", + "example": 250, + "start_line": 4044, + "end_line": 4056, + "section": "Block quotes" + }, + { + "markdown": ">>> foo\n> bar\n>>baz\n", + "html": "
\n
\n
\n

foo\nbar\nbaz

\n
\n
\n
\n", + "example": 251, + "start_line": 4059, + "end_line": 4073, + "section": "Block quotes" + }, + { + "markdown": "> code\n\n> not code\n", + "html": "
\n
code\n
\n
\n
\n

not code

\n
\n", + "example": 252, + "start_line": 4081, + "end_line": 4093, + "section": "Block quotes" + }, + { + "markdown": "A paragraph\nwith two lines.\n\n indented code\n\n> A block quote.\n", + "html": "

A paragraph\nwith two lines.

\n
indented code\n
\n
\n

A block quote.

\n
\n", + "example": 253, + "start_line": 4135, + "end_line": 4150, + "section": "List items" + }, + { + "markdown": "1. A paragraph\n with two lines.\n\n indented code\n\n > A block quote.\n", + "html": "
    \n
  1. \n

    A paragraph\nwith two lines.

    \n
    indented code\n
    \n
    \n

    A block quote.

    \n
    \n
  2. \n
\n", + "example": 254, + "start_line": 4157, + "end_line": 4176, + "section": "List items" + }, + { + "markdown": "- one\n\n two\n", + "html": "
    \n
  • one
  • \n
\n

two

\n", + "example": 255, + "start_line": 4190, + "end_line": 4199, + "section": "List items" + }, + { + "markdown": "- one\n\n two\n", + "html": "
    \n
  • \n

    one

    \n

    two

    \n
  • \n
\n", + "example": 256, + "start_line": 4202, + "end_line": 4213, + "section": "List items" + }, + { + "markdown": " - one\n\n two\n", + "html": "
    \n
  • one
  • \n
\n
 two\n
\n", + "example": 257, + "start_line": 4216, + "end_line": 4226, + "section": "List items" + }, + { + "markdown": " - one\n\n two\n", + "html": "
    \n
  • \n

    one

    \n

    two

    \n
  • \n
\n", + "example": 258, + "start_line": 4229, + "end_line": 4240, + "section": "List items" + }, + { + "markdown": " > > 1. one\n>>\n>> two\n", + "html": "
\n
\n
    \n
  1. \n

    one

    \n

    two

    \n
  2. \n
\n
\n
\n", + "example": 259, + "start_line": 4251, + "end_line": 4266, + "section": "List items" + }, + { + "markdown": ">>- one\n>>\n > > two\n", + "html": "
\n
\n
    \n
  • one
  • \n
\n

two

\n
\n
\n", + "example": 260, + "start_line": 4278, + "end_line": 4291, + "section": "List items" + }, + { + "markdown": "-one\n\n2.two\n", + "html": "

-one

\n

2.two

\n", + "example": 261, + "start_line": 4297, + "end_line": 4304, + "section": "List items" + }, + { + "markdown": "- foo\n\n\n bar\n", + "html": "
    \n
  • \n

    foo

    \n

    bar

    \n
  • \n
\n", + "example": 262, + "start_line": 4310, + "end_line": 4322, + "section": "List items" + }, + { + "markdown": "1. foo\n\n ```\n bar\n ```\n\n baz\n\n > bam\n", + "html": "
    \n
  1. \n

    foo

    \n
    bar\n
    \n

    baz

    \n
    \n

    bam

    \n
    \n
  2. \n
\n", + "example": 263, + "start_line": 4327, + "end_line": 4349, + "section": "List items" + }, + { + "markdown": "- Foo\n\n bar\n\n\n baz\n", + "html": "
    \n
  • \n

    Foo

    \n
    bar\n\n\nbaz\n
    \n
  • \n
\n", + "example": 264, + "start_line": 4355, + "end_line": 4373, + "section": "List items" + }, + { + "markdown": "123456789. ok\n", + "html": "
    \n
  1. ok
  2. \n
\n", + "example": 265, + "start_line": 4377, + "end_line": 4383, + "section": "List items" + }, + { + "markdown": "1234567890. not ok\n", + "html": "

1234567890. not ok

\n", + "example": 266, + "start_line": 4386, + "end_line": 4390, + "section": "List items" + }, + { + "markdown": "0. ok\n", + "html": "
    \n
  1. ok
  2. \n
\n", + "example": 267, + "start_line": 4395, + "end_line": 4401, + "section": "List items" + }, + { + "markdown": "003. ok\n", + "html": "
    \n
  1. ok
  2. \n
\n", + "example": 268, + "start_line": 4404, + "end_line": 4410, + "section": "List items" + }, + { + "markdown": "-1. not ok\n", + "html": "

-1. not ok

\n", + "example": 269, + "start_line": 4415, + "end_line": 4419, + "section": "List items" + }, + { + "markdown": "- foo\n\n bar\n", + "html": "
    \n
  • \n

    foo

    \n
    bar\n
    \n
  • \n
\n", + "example": 270, + "start_line": 4438, + "end_line": 4450, + "section": "List items" + }, + { + "markdown": " 10. foo\n\n bar\n", + "html": "
    \n
  1. \n

    foo

    \n
    bar\n
    \n
  2. \n
\n", + "example": 271, + "start_line": 4455, + "end_line": 4467, + "section": "List items" + }, + { + "markdown": " indented code\n\nparagraph\n\n more code\n", + "html": "
indented code\n
\n

paragraph

\n
more code\n
\n", + "example": 272, + "start_line": 4474, + "end_line": 4486, + "section": "List items" + }, + { + "markdown": "1. indented code\n\n paragraph\n\n more code\n", + "html": "
    \n
  1. \n
    indented code\n
    \n

    paragraph

    \n
    more code\n
    \n
  2. \n
\n", + "example": 273, + "start_line": 4489, + "end_line": 4505, + "section": "List items" + }, + { + "markdown": "1. indented code\n\n paragraph\n\n more code\n", + "html": "
    \n
  1. \n
     indented code\n
    \n

    paragraph

    \n
    more code\n
    \n
  2. \n
\n", + "example": 274, + "start_line": 4511, + "end_line": 4527, + "section": "List items" + }, + { + "markdown": " foo\n\nbar\n", + "html": "

foo

\n

bar

\n", + "example": 275, + "start_line": 4538, + "end_line": 4545, + "section": "List items" + }, + { + "markdown": "- foo\n\n bar\n", + "html": "
    \n
  • foo
  • \n
\n

bar

\n", + "example": 276, + "start_line": 4548, + "end_line": 4557, + "section": "List items" + }, + { + "markdown": "- foo\n\n bar\n", + "html": "
    \n
  • \n

    foo

    \n

    bar

    \n
  • \n
\n", + "example": 277, + "start_line": 4565, + "end_line": 4576, + "section": "List items" + }, + { + "markdown": "-\n foo\n-\n ```\n bar\n ```\n-\n baz\n", + "html": "
    \n
  • foo
  • \n
  • \n
    bar\n
    \n
  • \n
  • \n
    baz\n
    \n
  • \n
\n", + "example": 278, + "start_line": 4592, + "end_line": 4613, + "section": "List items" + }, + { + "markdown": "- \n foo\n", + "html": "
    \n
  • foo
  • \n
\n", + "example": 279, + "start_line": 4618, + "end_line": 4625, + "section": "List items" + }, + { + "markdown": "-\n\n foo\n", + "html": "
    \n
  • \n
\n

foo

\n", + "example": 280, + "start_line": 4632, + "end_line": 4641, + "section": "List items" + }, + { + "markdown": "- foo\n-\n- bar\n", + "html": "
    \n
  • foo
  • \n
  • \n
  • bar
  • \n
\n", + "example": 281, + "start_line": 4646, + "end_line": 4656, + "section": "List items" + }, + { + "markdown": "- foo\n- \n- bar\n", + "html": "
    \n
  • foo
  • \n
  • \n
  • bar
  • \n
\n", + "example": 282, + "start_line": 4661, + "end_line": 4671, + "section": "List items" + }, + { + "markdown": "1. foo\n2.\n3. bar\n", + "html": "
    \n
  1. foo
  2. \n
  3. \n
  4. bar
  5. \n
\n", + "example": 283, + "start_line": 4676, + "end_line": 4686, + "section": "List items" + }, + { + "markdown": "*\n", + "html": "
    \n
  • \n
\n", + "example": 284, + "start_line": 4691, + "end_line": 4697, + "section": "List items" + }, + { + "markdown": "foo\n*\n\nfoo\n1.\n", + "html": "

foo\n*

\n

foo\n1.

\n", + "example": 285, + "start_line": 4701, + "end_line": 4712, + "section": "List items" + }, + { + "markdown": " 1. A paragraph\n with two lines.\n\n indented code\n\n > A block quote.\n", + "html": "
    \n
  1. \n

    A paragraph\nwith two lines.

    \n
    indented code\n
    \n
    \n

    A block quote.

    \n
    \n
  2. \n
\n", + "example": 286, + "start_line": 4723, + "end_line": 4742, + "section": "List items" + }, + { + "markdown": " 1. A paragraph\n with two lines.\n\n indented code\n\n > A block quote.\n", + "html": "
    \n
  1. \n

    A paragraph\nwith two lines.

    \n
    indented code\n
    \n
    \n

    A block quote.

    \n
    \n
  2. \n
\n", + "example": 287, + "start_line": 4747, + "end_line": 4766, + "section": "List items" + }, + { + "markdown": " 1. A paragraph\n with two lines.\n\n indented code\n\n > A block quote.\n", + "html": "
    \n
  1. \n

    A paragraph\nwith two lines.

    \n
    indented code\n
    \n
    \n

    A block quote.

    \n
    \n
  2. \n
\n", + "example": 288, + "start_line": 4771, + "end_line": 4790, + "section": "List items" + }, + { + "markdown": " 1. A paragraph\n with two lines.\n\n indented code\n\n > A block quote.\n", + "html": "
1.  A paragraph\n    with two lines.\n\n        indented code\n\n    > A block quote.\n
\n", + "example": 289, + "start_line": 4795, + "end_line": 4810, + "section": "List items" + }, + { + "markdown": " 1. A paragraph\nwith two lines.\n\n indented code\n\n > A block quote.\n", + "html": "
    \n
  1. \n

    A paragraph\nwith two lines.

    \n
    indented code\n
    \n
    \n

    A block quote.

    \n
    \n
  2. \n
\n", + "example": 290, + "start_line": 4825, + "end_line": 4844, + "section": "List items" + }, + { + "markdown": " 1. A paragraph\n with two lines.\n", + "html": "
    \n
  1. A paragraph\nwith two lines.
  2. \n
\n", + "example": 291, + "start_line": 4849, + "end_line": 4857, + "section": "List items" + }, + { + "markdown": "> 1. > Blockquote\ncontinued here.\n", + "html": "
\n
    \n
  1. \n
    \n

    Blockquote\ncontinued here.

    \n
    \n
  2. \n
\n
\n", + "example": 292, + "start_line": 4862, + "end_line": 4876, + "section": "List items" + }, + { + "markdown": "> 1. > Blockquote\n> continued here.\n", + "html": "
\n
    \n
  1. \n
    \n

    Blockquote\ncontinued here.

    \n
    \n
  2. \n
\n
\n", + "example": 293, + "start_line": 4879, + "end_line": 4893, + "section": "List items" + }, + { + "markdown": "- foo\n - bar\n - baz\n - boo\n", + "html": "
    \n
  • foo\n
      \n
    • bar\n
        \n
      • baz\n
          \n
        • boo
        • \n
        \n
      • \n
      \n
    • \n
    \n
  • \n
\n", + "example": 294, + "start_line": 4907, + "end_line": 4928, + "section": "List items" + }, + { + "markdown": "- foo\n - bar\n - baz\n - boo\n", + "html": "
    \n
  • foo
  • \n
  • bar
  • \n
  • baz
  • \n
  • boo
  • \n
\n", + "example": 295, + "start_line": 4933, + "end_line": 4945, + "section": "List items" + }, + { + "markdown": "10) foo\n - bar\n", + "html": "
    \n
  1. foo\n
      \n
    • bar
    • \n
    \n
  2. \n
\n", + "example": 296, + "start_line": 4950, + "end_line": 4961, + "section": "List items" + }, + { + "markdown": "10) foo\n - bar\n", + "html": "
    \n
  1. foo
  2. \n
\n
    \n
  • bar
  • \n
\n", + "example": 297, + "start_line": 4966, + "end_line": 4976, + "section": "List items" + }, + { + "markdown": "- - foo\n", + "html": "
    \n
  • \n
      \n
    • foo
    • \n
    \n
  • \n
\n", + "example": 298, + "start_line": 4981, + "end_line": 4991, + "section": "List items" + }, + { + "markdown": "1. - 2. foo\n", + "html": "
    \n
  1. \n
      \n
    • \n
        \n
      1. foo
      2. \n
      \n
    • \n
    \n
  2. \n
\n", + "example": 299, + "start_line": 4994, + "end_line": 5008, + "section": "List items" + }, + { + "markdown": "- # Foo\n- Bar\n ---\n baz\n", + "html": "
    \n
  • \n

    Foo

    \n
  • \n
  • \n

    Bar

    \nbaz
  • \n
\n", + "example": 300, + "start_line": 5013, + "end_line": 5027, + "section": "List items" + }, + { + "markdown": "- foo\n- bar\n+ baz\n", + "html": "
    \n
  • foo
  • \n
  • bar
  • \n
\n
    \n
  • baz
  • \n
\n", + "example": 301, + "start_line": 5249, + "end_line": 5261, + "section": "Lists" + }, + { + "markdown": "1. foo\n2. bar\n3) baz\n", + "html": "
    \n
  1. foo
  2. \n
  3. bar
  4. \n
\n
    \n
  1. baz
  2. \n
\n", + "example": 302, + "start_line": 5264, + "end_line": 5276, + "section": "Lists" + }, + { + "markdown": "Foo\n- bar\n- baz\n", + "html": "

Foo

\n
    \n
  • bar
  • \n
  • baz
  • \n
\n", + "example": 303, + "start_line": 5283, + "end_line": 5293, + "section": "Lists" + }, + { + "markdown": "The number of windows in my house is\n14. The number of doors is 6.\n", + "html": "

The number of windows in my house is\n14. The number of doors is 6.

\n", + "example": 304, + "start_line": 5360, + "end_line": 5366, + "section": "Lists" + }, + { + "markdown": "The number of windows in my house is\n1. The number of doors is 6.\n", + "html": "

The number of windows in my house is

\n
    \n
  1. The number of doors is 6.
  2. \n
\n", + "example": 305, + "start_line": 5370, + "end_line": 5378, + "section": "Lists" + }, + { + "markdown": "- foo\n\n- bar\n\n\n- baz\n", + "html": "
    \n
  • \n

    foo

    \n
  • \n
  • \n

    bar

    \n
  • \n
  • \n

    baz

    \n
  • \n
\n", + "example": 306, + "start_line": 5384, + "end_line": 5403, + "section": "Lists" + }, + { + "markdown": "- foo\n - bar\n - baz\n\n\n bim\n", + "html": "
    \n
  • foo\n
      \n
    • bar\n
        \n
      • \n

        baz

        \n

        bim

        \n
      • \n
      \n
    • \n
    \n
  • \n
\n", + "example": 307, + "start_line": 5405, + "end_line": 5427, + "section": "Lists" + }, + { + "markdown": "- foo\n- bar\n\n\n\n- baz\n- bim\n", + "html": "
    \n
  • foo
  • \n
  • bar
  • \n
\n\n
    \n
  • baz
  • \n
  • bim
  • \n
\n", + "example": 308, + "start_line": 5435, + "end_line": 5453, + "section": "Lists" + }, + { + "markdown": "- foo\n\n notcode\n\n- foo\n\n\n\n code\n", + "html": "
    \n
  • \n

    foo

    \n

    notcode

    \n
  • \n
  • \n

    foo

    \n
  • \n
\n\n
code\n
\n", + "example": 309, + "start_line": 5456, + "end_line": 5479, + "section": "Lists" + }, + { + "markdown": "- a\n - b\n - c\n - d\n - e\n - f\n- g\n", + "html": "
    \n
  • a
  • \n
  • b
  • \n
  • c
  • \n
  • d
  • \n
  • e
  • \n
  • f
  • \n
  • g
  • \n
\n", + "example": 310, + "start_line": 5487, + "end_line": 5505, + "section": "Lists" + }, + { + "markdown": "1. a\n\n 2. b\n\n 3. c\n", + "html": "
    \n
  1. \n

    a

    \n
  2. \n
  3. \n

    b

    \n
  4. \n
  5. \n

    c

    \n
  6. \n
\n", + "example": 311, + "start_line": 5508, + "end_line": 5526, + "section": "Lists" + }, + { + "markdown": "- a\n - b\n - c\n - d\n - e\n", + "html": "
    \n
  • a
  • \n
  • b
  • \n
  • c
  • \n
  • d\n- e
  • \n
\n", + "example": 312, + "start_line": 5532, + "end_line": 5546, + "section": "Lists" + }, + { + "markdown": "1. a\n\n 2. b\n\n 3. c\n", + "html": "
    \n
  1. \n

    a

    \n
  2. \n
  3. \n

    b

    \n
  4. \n
\n
3. c\n
\n", + "example": 313, + "start_line": 5552, + "end_line": 5569, + "section": "Lists" + }, + { + "markdown": "- a\n- b\n\n- c\n", + "html": "
    \n
  • \n

    a

    \n
  • \n
  • \n

    b

    \n
  • \n
  • \n

    c

    \n
  • \n
\n", + "example": 314, + "start_line": 5575, + "end_line": 5592, + "section": "Lists" + }, + { + "markdown": "* a\n*\n\n* c\n", + "html": "
    \n
  • \n

    a

    \n
  • \n
  • \n
  • \n

    c

    \n
  • \n
\n", + "example": 315, + "start_line": 5597, + "end_line": 5612, + "section": "Lists" + }, + { + "markdown": "- a\n- b\n\n c\n- d\n", + "html": "
    \n
  • \n

    a

    \n
  • \n
  • \n

    b

    \n

    c

    \n
  • \n
  • \n

    d

    \n
  • \n
\n", + "example": 316, + "start_line": 5619, + "end_line": 5638, + "section": "Lists" + }, + { + "markdown": "- a\n- b\n\n [ref]: /url\n- d\n", + "html": "
    \n
  • \n

    a

    \n
  • \n
  • \n

    b

    \n
  • \n
  • \n

    d

    \n
  • \n
\n", + "example": 317, + "start_line": 5641, + "end_line": 5659, + "section": "Lists" + }, + { + "markdown": "- a\n- ```\n b\n\n\n ```\n- c\n", + "html": "
    \n
  • a
  • \n
  • \n
    b\n\n\n
    \n
  • \n
  • c
  • \n
\n", + "example": 318, + "start_line": 5664, + "end_line": 5683, + "section": "Lists" + }, + { + "markdown": "- a\n - b\n\n c\n- d\n", + "html": "
    \n
  • a\n
      \n
    • \n

      b

      \n

      c

      \n
    • \n
    \n
  • \n
  • d
  • \n
\n", + "example": 319, + "start_line": 5690, + "end_line": 5708, + "section": "Lists" + }, + { + "markdown": "* a\n > b\n >\n* c\n", + "html": "
    \n
  • a\n
    \n

    b

    \n
    \n
  • \n
  • c
  • \n
\n", + "example": 320, + "start_line": 5714, + "end_line": 5728, + "section": "Lists" + }, + { + "markdown": "- a\n > b\n ```\n c\n ```\n- d\n", + "html": "
    \n
  • a\n
    \n

    b

    \n
    \n
    c\n
    \n
  • \n
  • d
  • \n
\n", + "example": 321, + "start_line": 5734, + "end_line": 5752, + "section": "Lists" + }, + { + "markdown": "- a\n", + "html": "
    \n
  • a
  • \n
\n", + "example": 322, + "start_line": 5757, + "end_line": 5763, + "section": "Lists" + }, + { + "markdown": "- a\n - b\n", + "html": "
    \n
  • a\n
      \n
    • b
    • \n
    \n
  • \n
\n", + "example": 323, + "start_line": 5766, + "end_line": 5777, + "section": "Lists" + }, + { + "markdown": "1. ```\n foo\n ```\n\n bar\n", + "html": "
    \n
  1. \n
    foo\n
    \n

    bar

    \n
  2. \n
\n", + "example": 324, + "start_line": 5783, + "end_line": 5797, + "section": "Lists" + }, + { + "markdown": "* foo\n * bar\n\n baz\n", + "html": "
    \n
  • \n

    foo

    \n
      \n
    • bar
    • \n
    \n

    baz

    \n
  • \n
\n", + "example": 325, + "start_line": 5802, + "end_line": 5817, + "section": "Lists" + }, + { + "markdown": "- a\n - b\n - c\n\n- d\n - e\n - f\n", + "html": "
    \n
  • \n

    a

    \n
      \n
    • b
    • \n
    • c
    • \n
    \n
  • \n
  • \n

    d

    \n
      \n
    • e
    • \n
    • f
    • \n
    \n
  • \n
\n", + "example": 326, + "start_line": 5820, + "end_line": 5845, + "section": "Lists" + }, + { + "markdown": "`hi`lo`\n", + "html": "

hilo`

\n", + "example": 327, + "start_line": 5854, + "end_line": 5858, + "section": "Inlines" + }, + { + "markdown": "`foo`\n", + "html": "

foo

\n", + "example": 328, + "start_line": 5886, + "end_line": 5890, + "section": "Code spans" + }, + { + "markdown": "`` foo ` bar ``\n", + "html": "

foo ` bar

\n", + "example": 329, + "start_line": 5897, + "end_line": 5901, + "section": "Code spans" + }, + { + "markdown": "` `` `\n", + "html": "

``

\n", + "example": 330, + "start_line": 5907, + "end_line": 5911, + "section": "Code spans" + }, + { + "markdown": "` `` `\n", + "html": "

``

\n", + "example": 331, + "start_line": 5915, + "end_line": 5919, + "section": "Code spans" + }, + { + "markdown": "` a`\n", + "html": "

a

\n", + "example": 332, + "start_line": 5924, + "end_line": 5928, + "section": "Code spans" + }, + { + "markdown": "` b `\n", + "html": "

 b 

\n", + "example": 333, + "start_line": 5933, + "end_line": 5937, + "section": "Code spans" + }, + { + "markdown": "` `\n` `\n", + "html": "

 \n

\n", + "example": 334, + "start_line": 5941, + "end_line": 5947, + "section": "Code spans" + }, + { + "markdown": "``\nfoo\nbar \nbaz\n``\n", + "html": "

foo bar baz

\n", + "example": 335, + "start_line": 5952, + "end_line": 5960, + "section": "Code spans" + }, + { + "markdown": "``\nfoo \n``\n", + "html": "

foo

\n", + "example": 336, + "start_line": 5962, + "end_line": 5968, + "section": "Code spans" + }, + { + "markdown": "`foo bar \nbaz`\n", + "html": "

foo bar baz

\n", + "example": 337, + "start_line": 5973, + "end_line": 5978, + "section": "Code spans" + }, + { + "markdown": "`foo\\`bar`\n", + "html": "

foo\\bar`

\n", + "example": 338, + "start_line": 5990, + "end_line": 5994, + "section": "Code spans" + }, + { + "markdown": "``foo`bar``\n", + "html": "

foo`bar

\n", + "example": 339, + "start_line": 6001, + "end_line": 6005, + "section": "Code spans" + }, + { + "markdown": "` foo `` bar `\n", + "html": "

foo `` bar

\n", + "example": 340, + "start_line": 6007, + "end_line": 6011, + "section": "Code spans" + }, + { + "markdown": "*foo`*`\n", + "html": "

*foo*

\n", + "example": 341, + "start_line": 6019, + "end_line": 6023, + "section": "Code spans" + }, + { + "markdown": "[not a `link](/foo`)\n", + "html": "

[not a link](/foo)

\n", + "example": 342, + "start_line": 6028, + "end_line": 6032, + "section": "Code spans" + }, + { + "markdown": "``\n", + "html": "

<a href="">`

\n", + "example": 343, + "start_line": 6038, + "end_line": 6042, + "section": "Code spans" + }, + { + "markdown": "
`\n", + "html": "

`

\n", + "example": 344, + "start_line": 6047, + "end_line": 6051, + "section": "Code spans" + }, + { + "markdown": "``\n", + "html": "

<https://foo.bar.baz>`

\n", + "example": 345, + "start_line": 6056, + "end_line": 6060, + "section": "Code spans" + }, + { + "markdown": "`\n", + "html": "

https://foo.bar.`baz`

\n", + "example": 346, + "start_line": 6065, + "end_line": 6069, + "section": "Code spans" + }, + { + "markdown": "```foo``\n", + "html": "

```foo``

\n", + "example": 347, + "start_line": 6075, + "end_line": 6079, + "section": "Code spans" + }, + { + "markdown": "`foo\n", + "html": "

`foo

\n", + "example": 348, + "start_line": 6082, + "end_line": 6086, + "section": "Code spans" + }, + { + "markdown": "`foo``bar``\n", + "html": "

`foobar

\n", + "example": 349, + "start_line": 6091, + "end_line": 6095, + "section": "Code spans" + }, + { + "markdown": "*foo bar*\n", + "html": "

foo bar

\n", + "example": 350, + "start_line": 6308, + "end_line": 6312, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "a * foo bar*\n", + "html": "

a * foo bar*

\n", + "example": 351, + "start_line": 6318, + "end_line": 6322, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "a*\"foo\"*\n", + "html": "

a*"foo"*

\n", + "example": 352, + "start_line": 6329, + "end_line": 6333, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "* a *\n", + "html": "

* a *

\n", + "example": 353, + "start_line": 6338, + "end_line": 6342, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*$*alpha.\n\n*£*bravo.\n\n*€*charlie.\n", + "html": "

*$*alpha.

\n

*£*bravo.

\n

*€*charlie.

\n", + "example": 354, + "start_line": 6347, + "end_line": 6357, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo*bar*\n", + "html": "

foobar

\n", + "example": 355, + "start_line": 6362, + "end_line": 6366, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "5*6*78\n", + "html": "

5678

\n", + "example": 356, + "start_line": 6369, + "end_line": 6373, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo bar_\n", + "html": "

foo bar

\n", + "example": 357, + "start_line": 6378, + "end_line": 6382, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_ foo bar_\n", + "html": "

_ foo bar_

\n", + "example": 358, + "start_line": 6388, + "end_line": 6392, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "a_\"foo\"_\n", + "html": "

a_"foo"_

\n", + "example": 359, + "start_line": 6398, + "end_line": 6402, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo_bar_\n", + "html": "

foo_bar_

\n", + "example": 360, + "start_line": 6407, + "end_line": 6411, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "5_6_78\n", + "html": "

5_6_78

\n", + "example": 361, + "start_line": 6414, + "end_line": 6418, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "пристаням_стремятся_\n", + "html": "

пристаням_стремятся_

\n", + "example": 362, + "start_line": 6421, + "end_line": 6425, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "aa_\"bb\"_cc\n", + "html": "

aa_"bb"_cc

\n", + "example": 363, + "start_line": 6431, + "end_line": 6435, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo-_(bar)_\n", + "html": "

foo-(bar)

\n", + "example": 364, + "start_line": 6442, + "end_line": 6446, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo*\n", + "html": "

_foo*

\n", + "example": 365, + "start_line": 6454, + "end_line": 6458, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo bar *\n", + "html": "

*foo bar *

\n", + "example": 366, + "start_line": 6464, + "end_line": 6468, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo bar\n*\n", + "html": "

*foo bar\n*

\n", + "example": 367, + "start_line": 6473, + "end_line": 6479, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*(*foo)\n", + "html": "

*(*foo)

\n", + "example": 368, + "start_line": 6486, + "end_line": 6490, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*(*foo*)*\n", + "html": "

(foo)

\n", + "example": 369, + "start_line": 6496, + "end_line": 6500, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo*bar\n", + "html": "

foobar

\n", + "example": 370, + "start_line": 6505, + "end_line": 6509, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo bar _\n", + "html": "

_foo bar _

\n", + "example": 371, + "start_line": 6518, + "end_line": 6522, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_(_foo)\n", + "html": "

_(_foo)

\n", + "example": 372, + "start_line": 6528, + "end_line": 6532, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_(_foo_)_\n", + "html": "

(foo)

\n", + "example": 373, + "start_line": 6537, + "end_line": 6541, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo_bar\n", + "html": "

_foo_bar

\n", + "example": 374, + "start_line": 6546, + "end_line": 6550, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_пристаням_стремятся\n", + "html": "

_пристаням_стремятся

\n", + "example": 375, + "start_line": 6553, + "end_line": 6557, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo_bar_baz_\n", + "html": "

foo_bar_baz

\n", + "example": 376, + "start_line": 6560, + "end_line": 6564, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_(bar)_.\n", + "html": "

(bar).

\n", + "example": 377, + "start_line": 6571, + "end_line": 6575, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo bar**\n", + "html": "

foo bar

\n", + "example": 378, + "start_line": 6580, + "end_line": 6584, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "** foo bar**\n", + "html": "

** foo bar**

\n", + "example": 379, + "start_line": 6590, + "end_line": 6594, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "a**\"foo\"**\n", + "html": "

a**"foo"**

\n", + "example": 380, + "start_line": 6601, + "end_line": 6605, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo**bar**\n", + "html": "

foobar

\n", + "example": 381, + "start_line": 6610, + "end_line": 6614, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo bar__\n", + "html": "

foo bar

\n", + "example": 382, + "start_line": 6619, + "end_line": 6623, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__ foo bar__\n", + "html": "

__ foo bar__

\n", + "example": 383, + "start_line": 6629, + "end_line": 6633, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__\nfoo bar__\n", + "html": "

__\nfoo bar__

\n", + "example": 384, + "start_line": 6637, + "end_line": 6643, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "a__\"foo\"__\n", + "html": "

a__"foo"__

\n", + "example": 385, + "start_line": 6649, + "end_line": 6653, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo__bar__\n", + "html": "

foo__bar__

\n", + "example": 386, + "start_line": 6658, + "end_line": 6662, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "5__6__78\n", + "html": "

5__6__78

\n", + "example": 387, + "start_line": 6665, + "end_line": 6669, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "пристаням__стремятся__\n", + "html": "

пристаням__стремятся__

\n", + "example": 388, + "start_line": 6672, + "end_line": 6676, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo, __bar__, baz__\n", + "html": "

foo, bar, baz

\n", + "example": 389, + "start_line": 6679, + "end_line": 6683, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo-__(bar)__\n", + "html": "

foo-(bar)

\n", + "example": 390, + "start_line": 6690, + "end_line": 6694, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo bar **\n", + "html": "

**foo bar **

\n", + "example": 391, + "start_line": 6703, + "end_line": 6707, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**(**foo)\n", + "html": "

**(**foo)

\n", + "example": 392, + "start_line": 6716, + "end_line": 6720, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*(**foo**)*\n", + "html": "

(foo)

\n", + "example": 393, + "start_line": 6726, + "end_line": 6730, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**Gomphocarpus (*Gomphocarpus physocarpus*, syn.\n*Asclepias physocarpa*)**\n", + "html": "

Gomphocarpus (Gomphocarpus physocarpus, syn.\nAsclepias physocarpa)

\n", + "example": 394, + "start_line": 6733, + "end_line": 6739, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo \"*bar*\" foo**\n", + "html": "

foo "bar" foo

\n", + "example": 395, + "start_line": 6742, + "end_line": 6746, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo**bar\n", + "html": "

foobar

\n", + "example": 396, + "start_line": 6751, + "end_line": 6755, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo bar __\n", + "html": "

__foo bar __

\n", + "example": 397, + "start_line": 6763, + "end_line": 6767, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__(__foo)\n", + "html": "

__(__foo)

\n", + "example": 398, + "start_line": 6773, + "end_line": 6777, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_(__foo__)_\n", + "html": "

(foo)

\n", + "example": 399, + "start_line": 6783, + "end_line": 6787, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo__bar\n", + "html": "

__foo__bar

\n", + "example": 400, + "start_line": 6792, + "end_line": 6796, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__пристаням__стремятся\n", + "html": "

__пристаням__стремятся

\n", + "example": 401, + "start_line": 6799, + "end_line": 6803, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo__bar__baz__\n", + "html": "

foo__bar__baz

\n", + "example": 402, + "start_line": 6806, + "end_line": 6810, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__(bar)__.\n", + "html": "

(bar).

\n", + "example": 403, + "start_line": 6817, + "end_line": 6821, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo [bar](/url)*\n", + "html": "

foo bar

\n", + "example": 404, + "start_line": 6829, + "end_line": 6833, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo\nbar*\n", + "html": "

foo\nbar

\n", + "example": 405, + "start_line": 6836, + "end_line": 6842, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo __bar__ baz_\n", + "html": "

foo bar baz

\n", + "example": 406, + "start_line": 6848, + "end_line": 6852, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo _bar_ baz_\n", + "html": "

foo bar baz

\n", + "example": 407, + "start_line": 6855, + "end_line": 6859, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo_ bar_\n", + "html": "

foo bar

\n", + "example": 408, + "start_line": 6862, + "end_line": 6866, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo *bar**\n", + "html": "

foo bar

\n", + "example": 409, + "start_line": 6869, + "end_line": 6873, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo **bar** baz*\n", + "html": "

foo bar baz

\n", + "example": 410, + "start_line": 6876, + "end_line": 6880, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo**bar**baz*\n", + "html": "

foobarbaz

\n", + "example": 411, + "start_line": 6882, + "end_line": 6886, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo**bar*\n", + "html": "

foo**bar

\n", + "example": 412, + "start_line": 6906, + "end_line": 6910, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "***foo** bar*\n", + "html": "

foo bar

\n", + "example": 413, + "start_line": 6919, + "end_line": 6923, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo **bar***\n", + "html": "

foo bar

\n", + "example": 414, + "start_line": 6926, + "end_line": 6930, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo**bar***\n", + "html": "

foobar

\n", + "example": 415, + "start_line": 6933, + "end_line": 6937, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo***bar***baz\n", + "html": "

foobarbaz

\n", + "example": 416, + "start_line": 6944, + "end_line": 6948, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo******bar*********baz\n", + "html": "

foobar***baz

\n", + "example": 417, + "start_line": 6950, + "end_line": 6954, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo **bar *baz* bim** bop*\n", + "html": "

foo bar baz bim bop

\n", + "example": 418, + "start_line": 6959, + "end_line": 6963, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo [*bar*](/url)*\n", + "html": "

foo bar

\n", + "example": 419, + "start_line": 6966, + "end_line": 6970, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "** is not an empty emphasis\n", + "html": "

** is not an empty emphasis

\n", + "example": 420, + "start_line": 6975, + "end_line": 6979, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**** is not an empty strong emphasis\n", + "html": "

**** is not an empty strong emphasis

\n", + "example": 421, + "start_line": 6982, + "end_line": 6986, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo [bar](/url)**\n", + "html": "

foo bar

\n", + "example": 422, + "start_line": 6995, + "end_line": 6999, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo\nbar**\n", + "html": "

foo\nbar

\n", + "example": 423, + "start_line": 7002, + "end_line": 7008, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo _bar_ baz__\n", + "html": "

foo bar baz

\n", + "example": 424, + "start_line": 7014, + "end_line": 7018, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo __bar__ baz__\n", + "html": "

foo bar baz

\n", + "example": 425, + "start_line": 7021, + "end_line": 7025, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "____foo__ bar__\n", + "html": "

foo bar

\n", + "example": 426, + "start_line": 7028, + "end_line": 7032, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo **bar****\n", + "html": "

foo bar

\n", + "example": 427, + "start_line": 7035, + "end_line": 7039, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo *bar* baz**\n", + "html": "

foo bar baz

\n", + "example": 428, + "start_line": 7042, + "end_line": 7046, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo*bar*baz**\n", + "html": "

foobarbaz

\n", + "example": 429, + "start_line": 7049, + "end_line": 7053, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "***foo* bar**\n", + "html": "

foo bar

\n", + "example": 430, + "start_line": 7056, + "end_line": 7060, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo *bar***\n", + "html": "

foo bar

\n", + "example": 431, + "start_line": 7063, + "end_line": 7067, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo *bar **baz**\nbim* bop**\n", + "html": "

foo bar baz\nbim bop

\n", + "example": 432, + "start_line": 7072, + "end_line": 7078, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo [*bar*](/url)**\n", + "html": "

foo bar

\n", + "example": 433, + "start_line": 7081, + "end_line": 7085, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__ is not an empty emphasis\n", + "html": "

__ is not an empty emphasis

\n", + "example": 434, + "start_line": 7090, + "end_line": 7094, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "____ is not an empty strong emphasis\n", + "html": "

____ is not an empty strong emphasis

\n", + "example": 435, + "start_line": 7097, + "end_line": 7101, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo ***\n", + "html": "

foo ***

\n", + "example": 436, + "start_line": 7107, + "end_line": 7111, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo *\\**\n", + "html": "

foo *

\n", + "example": 437, + "start_line": 7114, + "end_line": 7118, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo *_*\n", + "html": "

foo _

\n", + "example": 438, + "start_line": 7121, + "end_line": 7125, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo *****\n", + "html": "

foo *****

\n", + "example": 439, + "start_line": 7128, + "end_line": 7132, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo **\\***\n", + "html": "

foo *

\n", + "example": 440, + "start_line": 7135, + "end_line": 7139, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo **_**\n", + "html": "

foo _

\n", + "example": 441, + "start_line": 7142, + "end_line": 7146, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo*\n", + "html": "

*foo

\n", + "example": 442, + "start_line": 7153, + "end_line": 7157, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo**\n", + "html": "

foo*

\n", + "example": 443, + "start_line": 7160, + "end_line": 7164, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "***foo**\n", + "html": "

*foo

\n", + "example": 444, + "start_line": 7167, + "end_line": 7171, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "****foo*\n", + "html": "

***foo

\n", + "example": 445, + "start_line": 7174, + "end_line": 7178, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo***\n", + "html": "

foo*

\n", + "example": 446, + "start_line": 7181, + "end_line": 7185, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo****\n", + "html": "

foo***

\n", + "example": 447, + "start_line": 7188, + "end_line": 7192, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo ___\n", + "html": "

foo ___

\n", + "example": 448, + "start_line": 7198, + "end_line": 7202, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo _\\__\n", + "html": "

foo _

\n", + "example": 449, + "start_line": 7205, + "end_line": 7209, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo _*_\n", + "html": "

foo *

\n", + "example": 450, + "start_line": 7212, + "end_line": 7216, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo _____\n", + "html": "

foo _____

\n", + "example": 451, + "start_line": 7219, + "end_line": 7223, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo __\\___\n", + "html": "

foo _

\n", + "example": 452, + "start_line": 7226, + "end_line": 7230, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "foo __*__\n", + "html": "

foo *

\n", + "example": 453, + "start_line": 7233, + "end_line": 7237, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo_\n", + "html": "

_foo

\n", + "example": 454, + "start_line": 7240, + "end_line": 7244, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo__\n", + "html": "

foo_

\n", + "example": 455, + "start_line": 7251, + "end_line": 7255, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "___foo__\n", + "html": "

_foo

\n", + "example": 456, + "start_line": 7258, + "end_line": 7262, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "____foo_\n", + "html": "

___foo

\n", + "example": 457, + "start_line": 7265, + "end_line": 7269, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo___\n", + "html": "

foo_

\n", + "example": 458, + "start_line": 7272, + "end_line": 7276, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo____\n", + "html": "

foo___

\n", + "example": 459, + "start_line": 7279, + "end_line": 7283, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo**\n", + "html": "

foo

\n", + "example": 460, + "start_line": 7289, + "end_line": 7293, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*_foo_*\n", + "html": "

foo

\n", + "example": 461, + "start_line": 7296, + "end_line": 7300, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__foo__\n", + "html": "

foo

\n", + "example": 462, + "start_line": 7303, + "end_line": 7307, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_*foo*_\n", + "html": "

foo

\n", + "example": 463, + "start_line": 7310, + "end_line": 7314, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "****foo****\n", + "html": "

foo

\n", + "example": 464, + "start_line": 7320, + "end_line": 7324, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "____foo____\n", + "html": "

foo

\n", + "example": 465, + "start_line": 7327, + "end_line": 7331, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "******foo******\n", + "html": "

foo

\n", + "example": 466, + "start_line": 7338, + "end_line": 7342, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "***foo***\n", + "html": "

foo

\n", + "example": 467, + "start_line": 7347, + "end_line": 7351, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_____foo_____\n", + "html": "

foo

\n", + "example": 468, + "start_line": 7354, + "end_line": 7358, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo _bar* baz_\n", + "html": "

foo _bar baz_

\n", + "example": 469, + "start_line": 7363, + "end_line": 7367, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo __bar *baz bim__ bam*\n", + "html": "

foo bar *baz bim bam

\n", + "example": 470, + "start_line": 7370, + "end_line": 7374, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**foo **bar baz**\n", + "html": "

**foo bar baz

\n", + "example": 471, + "start_line": 7379, + "end_line": 7383, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*foo *bar baz*\n", + "html": "

*foo bar baz

\n", + "example": 472, + "start_line": 7386, + "end_line": 7390, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*[bar*](/url)\n", + "html": "

*bar*

\n", + "example": 473, + "start_line": 7395, + "end_line": 7399, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_foo [bar_](/url)\n", + "html": "

_foo bar_

\n", + "example": 474, + "start_line": 7402, + "end_line": 7406, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*\n", + "html": "

*

\n", + "example": 475, + "start_line": 7409, + "end_line": 7413, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**\n", + "html": "

**

\n", + "example": 476, + "start_line": 7416, + "end_line": 7420, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__\n", + "html": "

__

\n", + "example": 477, + "start_line": 7423, + "end_line": 7427, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "*a `*`*\n", + "html": "

a *

\n", + "example": 478, + "start_line": 7430, + "end_line": 7434, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "_a `_`_\n", + "html": "

a _

\n", + "example": 479, + "start_line": 7437, + "end_line": 7441, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "**a\n", + "html": "

**ahttps://foo.bar/?q=**

\n", + "example": 480, + "start_line": 7444, + "end_line": 7448, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "__a\n", + "html": "

__ahttps://foo.bar/?q=__

\n", + "example": 481, + "start_line": 7451, + "end_line": 7455, + "section": "Emphasis and strong emphasis" + }, + { + "markdown": "[link](/uri \"title\")\n", + "html": "

link

\n", + "example": 482, + "start_line": 7539, + "end_line": 7543, + "section": "Links" + }, + { + "markdown": "[link](/uri)\n", + "html": "

link

\n", + "example": 483, + "start_line": 7549, + "end_line": 7553, + "section": "Links" + }, + { + "markdown": "[](./target.md)\n", + "html": "

\n", + "example": 484, + "start_line": 7555, + "end_line": 7559, + "section": "Links" + }, + { + "markdown": "[link]()\n", + "html": "

link

\n", + "example": 485, + "start_line": 7562, + "end_line": 7566, + "section": "Links" + }, + { + "markdown": "[link](<>)\n", + "html": "

link

\n", + "example": 486, + "start_line": 7569, + "end_line": 7573, + "section": "Links" + }, + { + "markdown": "[]()\n", + "html": "

\n", + "example": 487, + "start_line": 7576, + "end_line": 7580, + "section": "Links" + }, + { + "markdown": "[link](/my uri)\n", + "html": "

[link](/my uri)

\n", + "example": 488, + "start_line": 7585, + "end_line": 7589, + "section": "Links" + }, + { + "markdown": "[link](
)\n", + "html": "

link

\n", + "example": 489, + "start_line": 7591, + "end_line": 7595, + "section": "Links" + }, + { + "markdown": "[link](foo\nbar)\n", + "html": "

[link](foo\nbar)

\n", + "example": 490, + "start_line": 7600, + "end_line": 7606, + "section": "Links" + }, + { + "markdown": "[link]()\n", + "html": "

[link]()

\n", + "example": 491, + "start_line": 7608, + "end_line": 7614, + "section": "Links" + }, + { + "markdown": "[a]()\n", + "html": "

a

\n", + "example": 492, + "start_line": 7619, + "end_line": 7623, + "section": "Links" + }, + { + "markdown": "[link]()\n", + "html": "

[link](<foo>)

\n", + "example": 493, + "start_line": 7627, + "end_line": 7631, + "section": "Links" + }, + { + "markdown": "[a](\n[a](c)\n", + "html": "

[a](<b)c\n[a](<b)c>\n[a](c)

\n", + "example": 494, + "start_line": 7636, + "end_line": 7644, + "section": "Links" + }, + { + "markdown": "[link](\\(foo\\))\n", + "html": "

link

\n", + "example": 495, + "start_line": 7648, + "end_line": 7652, + "section": "Links" + }, + { + "markdown": "[link](foo(and(bar)))\n", + "html": "

link

\n", + "example": 496, + "start_line": 7657, + "end_line": 7661, + "section": "Links" + }, + { + "markdown": "[link](foo(and(bar))\n", + "html": "

[link](foo(and(bar))

\n", + "example": 497, + "start_line": 7666, + "end_line": 7670, + "section": "Links" + }, + { + "markdown": "[link](foo\\(and\\(bar\\))\n", + "html": "

link

\n", + "example": 498, + "start_line": 7673, + "end_line": 7677, + "section": "Links" + }, + { + "markdown": "[link]()\n", + "html": "

link

\n", + "example": 499, + "start_line": 7680, + "end_line": 7684, + "section": "Links" + }, + { + "markdown": "[link](foo\\)\\:)\n", + "html": "

link

\n", + "example": 500, + "start_line": 7690, + "end_line": 7694, + "section": "Links" + }, + { + "markdown": "[link](#fragment)\n\n[link](https://example.com#fragment)\n\n[link](https://example.com?foo=3#frag)\n", + "html": "

link

\n

link

\n

link

\n", + "example": 501, + "start_line": 7699, + "end_line": 7709, + "section": "Links" + }, + { + "markdown": "[link](foo\\bar)\n", + "html": "

link

\n", + "example": 502, + "start_line": 7715, + "end_line": 7719, + "section": "Links" + }, + { + "markdown": "[link](foo%20bä)\n", + "html": "

link

\n", + "example": 503, + "start_line": 7731, + "end_line": 7735, + "section": "Links" + }, + { + "markdown": "[link](\"title\")\n", + "html": "

link

\n", + "example": 504, + "start_line": 7742, + "end_line": 7746, + "section": "Links" + }, + { + "markdown": "[link](/url \"title\")\n[link](/url 'title')\n[link](/url (title))\n", + "html": "

link\nlink\nlink

\n", + "example": 505, + "start_line": 7751, + "end_line": 7759, + "section": "Links" + }, + { + "markdown": "[link](/url \"title \\\""\")\n", + "html": "

link

\n", + "example": 506, + "start_line": 7765, + "end_line": 7769, + "section": "Links" + }, + { + "markdown": "[link](/url \"title\")\n", + "html": "

link

\n", + "example": 507, + "start_line": 7776, + "end_line": 7780, + "section": "Links" + }, + { + "markdown": "[link](/url \"title \"and\" title\")\n", + "html": "

[link](/url "title "and" title")

\n", + "example": 508, + "start_line": 7785, + "end_line": 7789, + "section": "Links" + }, + { + "markdown": "[link](/url 'title \"and\" title')\n", + "html": "

link

\n", + "example": 509, + "start_line": 7794, + "end_line": 7798, + "section": "Links" + }, + { + "markdown": "[link]( /uri\n \"title\" )\n", + "html": "

link

\n", + "example": 510, + "start_line": 7819, + "end_line": 7824, + "section": "Links" + }, + { + "markdown": "[link] (/uri)\n", + "html": "

[link] (/uri)

\n", + "example": 511, + "start_line": 7830, + "end_line": 7834, + "section": "Links" + }, + { + "markdown": "[link [foo [bar]]](/uri)\n", + "html": "

link [foo [bar]]

\n", + "example": 512, + "start_line": 7840, + "end_line": 7844, + "section": "Links" + }, + { + "markdown": "[link] bar](/uri)\n", + "html": "

[link] bar](/uri)

\n", + "example": 513, + "start_line": 7847, + "end_line": 7851, + "section": "Links" + }, + { + "markdown": "[link [bar](/uri)\n", + "html": "

[link bar

\n", + "example": 514, + "start_line": 7854, + "end_line": 7858, + "section": "Links" + }, + { + "markdown": "[link \\[bar](/uri)\n", + "html": "

link [bar

\n", + "example": 515, + "start_line": 7861, + "end_line": 7865, + "section": "Links" + }, + { + "markdown": "[link *foo **bar** `#`*](/uri)\n", + "html": "

link foo bar #

\n", + "example": 516, + "start_line": 7870, + "end_line": 7874, + "section": "Links" + }, + { + "markdown": "[![moon](moon.jpg)](/uri)\n", + "html": "

\"moon\"

\n", + "example": 517, + "start_line": 7877, + "end_line": 7881, + "section": "Links" + }, + { + "markdown": "[foo [bar](/uri)](/uri)\n", + "html": "

[foo bar](/uri)

\n", + "example": 518, + "start_line": 7886, + "end_line": 7890, + "section": "Links" + }, + { + "markdown": "[foo *[bar [baz](/uri)](/uri)*](/uri)\n", + "html": "

[foo [bar baz](/uri)](/uri)

\n", + "example": 519, + "start_line": 7893, + "end_line": 7897, + "section": "Links" + }, + { + "markdown": "![[[foo](uri1)](uri2)](uri3)\n", + "html": "

\"[foo](uri2)\"

\n", + "example": 520, + "start_line": 7900, + "end_line": 7904, + "section": "Links" + }, + { + "markdown": "*[foo*](/uri)\n", + "html": "

*foo*

\n", + "example": 521, + "start_line": 7910, + "end_line": 7914, + "section": "Links" + }, + { + "markdown": "[foo *bar](baz*)\n", + "html": "

foo *bar

\n", + "example": 522, + "start_line": 7917, + "end_line": 7921, + "section": "Links" + }, + { + "markdown": "*foo [bar* baz]\n", + "html": "

foo [bar baz]

\n", + "example": 523, + "start_line": 7927, + "end_line": 7931, + "section": "Links" + }, + { + "markdown": "[foo \n", + "html": "

[foo

\n", + "example": 524, + "start_line": 7937, + "end_line": 7941, + "section": "Links" + }, + { + "markdown": "[foo`](/uri)`\n", + "html": "

[foo](/uri)

\n", + "example": 525, + "start_line": 7944, + "end_line": 7948, + "section": "Links" + }, + { + "markdown": "[foo\n", + "html": "

[foohttps://example.com/?search=](uri)

\n", + "example": 526, + "start_line": 7951, + "end_line": 7955, + "section": "Links" + }, + { + "markdown": "[foo][bar]\n\n[bar]: /url \"title\"\n", + "html": "

foo

\n", + "example": 527, + "start_line": 7989, + "end_line": 7995, + "section": "Links" + }, + { + "markdown": "[link [foo [bar]]][ref]\n\n[ref]: /uri\n", + "html": "

link [foo [bar]]

\n", + "example": 528, + "start_line": 8004, + "end_line": 8010, + "section": "Links" + }, + { + "markdown": "[link \\[bar][ref]\n\n[ref]: /uri\n", + "html": "

link [bar

\n", + "example": 529, + "start_line": 8013, + "end_line": 8019, + "section": "Links" + }, + { + "markdown": "[link *foo **bar** `#`*][ref]\n\n[ref]: /uri\n", + "html": "

link foo bar #

\n", + "example": 530, + "start_line": 8024, + "end_line": 8030, + "section": "Links" + }, + { + "markdown": "[![moon](moon.jpg)][ref]\n\n[ref]: /uri\n", + "html": "

\"moon\"

\n", + "example": 531, + "start_line": 8033, + "end_line": 8039, + "section": "Links" + }, + { + "markdown": "[foo [bar](/uri)][ref]\n\n[ref]: /uri\n", + "html": "

[foo bar]ref

\n", + "example": 532, + "start_line": 8044, + "end_line": 8050, + "section": "Links" + }, + { + "markdown": "[foo *bar [baz][ref]*][ref]\n\n[ref]: /uri\n", + "html": "

[foo bar baz]ref

\n", + "example": 533, + "start_line": 8053, + "end_line": 8059, + "section": "Links" + }, + { + "markdown": "*[foo*][ref]\n\n[ref]: /uri\n", + "html": "

*foo*

\n", + "example": 534, + "start_line": 8068, + "end_line": 8074, + "section": "Links" + }, + { + "markdown": "[foo *bar][ref]*\n\n[ref]: /uri\n", + "html": "

foo *bar*

\n", + "example": 535, + "start_line": 8077, + "end_line": 8083, + "section": "Links" + }, + { + "markdown": "[foo \n\n[ref]: /uri\n", + "html": "

[foo

\n", + "example": 536, + "start_line": 8089, + "end_line": 8095, + "section": "Links" + }, + { + "markdown": "[foo`][ref]`\n\n[ref]: /uri\n", + "html": "

[foo][ref]

\n", + "example": 537, + "start_line": 8098, + "end_line": 8104, + "section": "Links" + }, + { + "markdown": "[foo\n\n[ref]: /uri\n", + "html": "

[foohttps://example.com/?search=][ref]

\n", + "example": 538, + "start_line": 8107, + "end_line": 8113, + "section": "Links" + }, + { + "markdown": "[foo][BaR]\n\n[bar]: /url \"title\"\n", + "html": "

foo

\n", + "example": 539, + "start_line": 8118, + "end_line": 8124, + "section": "Links" + }, + { + "markdown": "[ẞ]\n\n[SS]: /url\n", + "html": "

\n", + "example": 540, + "start_line": 8129, + "end_line": 8135, + "section": "Links" + }, + { + "markdown": "[Foo\n bar]: /url\n\n[Baz][Foo bar]\n", + "html": "

Baz

\n", + "example": 541, + "start_line": 8141, + "end_line": 8148, + "section": "Links" + }, + { + "markdown": "[foo] [bar]\n\n[bar]: /url \"title\"\n", + "html": "

[foo] bar

\n", + "example": 542, + "start_line": 8154, + "end_line": 8160, + "section": "Links" + }, + { + "markdown": "[foo]\n[bar]\n\n[bar]: /url \"title\"\n", + "html": "

[foo]\nbar

\n", + "example": 543, + "start_line": 8163, + "end_line": 8171, + "section": "Links" + }, + { + "markdown": "[foo]: /url1\n\n[foo]: /url2\n\n[bar][foo]\n", + "html": "

bar

\n", + "example": 544, + "start_line": 8204, + "end_line": 8212, + "section": "Links" + }, + { + "markdown": "[bar][foo\\!]\n\n[foo!]: /url\n", + "html": "

[bar][foo!]

\n", + "example": 545, + "start_line": 8219, + "end_line": 8225, + "section": "Links" + }, + { + "markdown": "[foo][ref[]\n\n[ref[]: /uri\n", + "html": "

[foo][ref[]

\n

[ref[]: /uri

\n", + "example": 546, + "start_line": 8231, + "end_line": 8238, + "section": "Links" + }, + { + "markdown": "[foo][ref[bar]]\n\n[ref[bar]]: /uri\n", + "html": "

[foo][ref[bar]]

\n

[ref[bar]]: /uri

\n", + "example": 547, + "start_line": 8241, + "end_line": 8248, + "section": "Links" + }, + { + "markdown": "[[[foo]]]\n\n[[[foo]]]: /url\n", + "html": "

[[[foo]]]

\n

[[[foo]]]: /url

\n", + "example": 548, + "start_line": 8251, + "end_line": 8258, + "section": "Links" + }, + { + "markdown": "[foo][ref\\[]\n\n[ref\\[]: /uri\n", + "html": "

foo

\n", + "example": 549, + "start_line": 8261, + "end_line": 8267, + "section": "Links" + }, + { + "markdown": "[bar\\\\]: /uri\n\n[bar\\\\]\n", + "html": "

bar\\

\n", + "example": 550, + "start_line": 8272, + "end_line": 8278, + "section": "Links" + }, + { + "markdown": "[]\n\n[]: /uri\n", + "html": "

[]

\n

[]: /uri

\n", + "example": 551, + "start_line": 8284, + "end_line": 8291, + "section": "Links" + }, + { + "markdown": "[\n ]\n\n[\n ]: /uri\n", + "html": "

[\n]

\n

[\n]: /uri

\n", + "example": 552, + "start_line": 8294, + "end_line": 8305, + "section": "Links" + }, + { + "markdown": "[foo][]\n\n[foo]: /url \"title\"\n", + "html": "

foo

\n", + "example": 553, + "start_line": 8317, + "end_line": 8323, + "section": "Links" + }, + { + "markdown": "[*foo* bar][]\n\n[*foo* bar]: /url \"title\"\n", + "html": "

foo bar

\n", + "example": 554, + "start_line": 8326, + "end_line": 8332, + "section": "Links" + }, + { + "markdown": "[Foo][]\n\n[foo]: /url \"title\"\n", + "html": "

Foo

\n", + "example": 555, + "start_line": 8337, + "end_line": 8343, + "section": "Links" + }, + { + "markdown": "[foo] \n[]\n\n[foo]: /url \"title\"\n", + "html": "

foo\n[]

\n", + "example": 556, + "start_line": 8350, + "end_line": 8358, + "section": "Links" + }, + { + "markdown": "[foo]\n\n[foo]: /url \"title\"\n", + "html": "

foo

\n", + "example": 557, + "start_line": 8370, + "end_line": 8376, + "section": "Links" + }, + { + "markdown": "[*foo* bar]\n\n[*foo* bar]: /url \"title\"\n", + "html": "

foo bar

\n", + "example": 558, + "start_line": 8379, + "end_line": 8385, + "section": "Links" + }, + { + "markdown": "[[*foo* bar]]\n\n[*foo* bar]: /url \"title\"\n", + "html": "

[foo bar]

\n", + "example": 559, + "start_line": 8388, + "end_line": 8394, + "section": "Links" + }, + { + "markdown": "[[bar [foo]\n\n[foo]: /url\n", + "html": "

[[bar foo

\n", + "example": 560, + "start_line": 8397, + "end_line": 8403, + "section": "Links" + }, + { + "markdown": "[Foo]\n\n[foo]: /url \"title\"\n", + "html": "

Foo

\n", + "example": 561, + "start_line": 8408, + "end_line": 8414, + "section": "Links" + }, + { + "markdown": "[foo] bar\n\n[foo]: /url\n", + "html": "

foo bar

\n", + "example": 562, + "start_line": 8419, + "end_line": 8425, + "section": "Links" + }, + { + "markdown": "\\[foo]\n\n[foo]: /url \"title\"\n", + "html": "

[foo]

\n", + "example": 563, + "start_line": 8431, + "end_line": 8437, + "section": "Links" + }, + { + "markdown": "[foo*]: /url\n\n*[foo*]\n", + "html": "

*foo*

\n", + "example": 564, + "start_line": 8443, + "end_line": 8449, + "section": "Links" + }, + { + "markdown": "[foo][bar]\n\n[foo]: /url1\n[bar]: /url2\n", + "html": "

foo

\n", + "example": 565, + "start_line": 8455, + "end_line": 8462, + "section": "Links" + }, + { + "markdown": "[foo][]\n\n[foo]: /url1\n", + "html": "

foo

\n", + "example": 566, + "start_line": 8464, + "end_line": 8470, + "section": "Links" + }, + { + "markdown": "[foo]()\n\n[foo]: /url1\n", + "html": "

foo

\n", + "example": 567, + "start_line": 8474, + "end_line": 8480, + "section": "Links" + }, + { + "markdown": "[foo](not a link)\n\n[foo]: /url1\n", + "html": "

foo(not a link)

\n", + "example": 568, + "start_line": 8482, + "end_line": 8488, + "section": "Links" + }, + { + "markdown": "[foo][bar][baz]\n\n[baz]: /url\n", + "html": "

[foo]bar

\n", + "example": 569, + "start_line": 8493, + "end_line": 8499, + "section": "Links" + }, + { + "markdown": "[foo][bar][baz]\n\n[baz]: /url1\n[bar]: /url2\n", + "html": "

foobaz

\n", + "example": 570, + "start_line": 8505, + "end_line": 8512, + "section": "Links" + }, + { + "markdown": "[foo][bar][baz]\n\n[baz]: /url1\n[foo]: /url2\n", + "html": "

[foo]bar

\n", + "example": 571, + "start_line": 8518, + "end_line": 8525, + "section": "Links" + }, + { + "markdown": "![foo](/url \"title\")\n", + "html": "

\"foo\"

\n", + "example": 572, + "start_line": 8541, + "end_line": 8545, + "section": "Images" + }, + { + "markdown": "![foo *bar*]\n\n[foo *bar*]: train.jpg \"train & tracks\"\n", + "html": "

\"foo

\n", + "example": 573, + "start_line": 8548, + "end_line": 8554, + "section": "Images" + }, + { + "markdown": "![foo ![bar](/url)](/url2)\n", + "html": "

\"foo

\n", + "example": 574, + "start_line": 8557, + "end_line": 8561, + "section": "Images" + }, + { + "markdown": "![foo [bar](/url)](/url2)\n", + "html": "

\"foo

\n", + "example": 575, + "start_line": 8564, + "end_line": 8568, + "section": "Images" + }, + { + "markdown": "![foo *bar*][]\n\n[foo *bar*]: train.jpg \"train & tracks\"\n", + "html": "

\"foo

\n", + "example": 576, + "start_line": 8578, + "end_line": 8584, + "section": "Images" + }, + { + "markdown": "![foo *bar*][foobar]\n\n[FOOBAR]: train.jpg \"train & tracks\"\n", + "html": "

\"foo

\n", + "example": 577, + "start_line": 8587, + "end_line": 8593, + "section": "Images" + }, + { + "markdown": "![foo](train.jpg)\n", + "html": "

\"foo\"

\n", + "example": 578, + "start_line": 8596, + "end_line": 8600, + "section": "Images" + }, + { + "markdown": "My ![foo bar](/path/to/train.jpg \"title\" )\n", + "html": "

My \"foo

\n", + "example": 579, + "start_line": 8603, + "end_line": 8607, + "section": "Images" + }, + { + "markdown": "![foo]()\n", + "html": "

\"foo\"

\n", + "example": 580, + "start_line": 8610, + "end_line": 8614, + "section": "Images" + }, + { + "markdown": "![](/url)\n", + "html": "

\"\"

\n", + "example": 581, + "start_line": 8617, + "end_line": 8621, + "section": "Images" + }, + { + "markdown": "![foo][bar]\n\n[bar]: /url\n", + "html": "

\"foo\"

\n", + "example": 582, + "start_line": 8626, + "end_line": 8632, + "section": "Images" + }, + { + "markdown": "![foo][bar]\n\n[BAR]: /url\n", + "html": "

\"foo\"

\n", + "example": 583, + "start_line": 8635, + "end_line": 8641, + "section": "Images" + }, + { + "markdown": "![foo][]\n\n[foo]: /url \"title\"\n", + "html": "

\"foo\"

\n", + "example": 584, + "start_line": 8646, + "end_line": 8652, + "section": "Images" + }, + { + "markdown": "![*foo* bar][]\n\n[*foo* bar]: /url \"title\"\n", + "html": "

\"foo

\n", + "example": 585, + "start_line": 8655, + "end_line": 8661, + "section": "Images" + }, + { + "markdown": "![Foo][]\n\n[foo]: /url \"title\"\n", + "html": "

\"Foo\"

\n", + "example": 586, + "start_line": 8666, + "end_line": 8672, + "section": "Images" + }, + { + "markdown": "![foo] \n[]\n\n[foo]: /url \"title\"\n", + "html": "

\"foo\"\n[]

\n", + "example": 587, + "start_line": 8678, + "end_line": 8686, + "section": "Images" + }, + { + "markdown": "![foo]\n\n[foo]: /url \"title\"\n", + "html": "

\"foo\"

\n", + "example": 588, + "start_line": 8691, + "end_line": 8697, + "section": "Images" + }, + { + "markdown": "![*foo* bar]\n\n[*foo* bar]: /url \"title\"\n", + "html": "

\"foo

\n", + "example": 589, + "start_line": 8700, + "end_line": 8706, + "section": "Images" + }, + { + "markdown": "![[foo]]\n\n[[foo]]: /url \"title\"\n", + "html": "

![[foo]]

\n

[[foo]]: /url "title"

\n", + "example": 590, + "start_line": 8711, + "end_line": 8718, + "section": "Images" + }, + { + "markdown": "![Foo]\n\n[foo]: /url \"title\"\n", + "html": "

\"Foo\"

\n", + "example": 591, + "start_line": 8723, + "end_line": 8729, + "section": "Images" + }, + { + "markdown": "!\\[foo]\n\n[foo]: /url \"title\"\n", + "html": "

![foo]

\n", + "example": 592, + "start_line": 8735, + "end_line": 8741, + "section": "Images" + }, + { + "markdown": "\\![foo]\n\n[foo]: /url \"title\"\n", + "html": "

!foo

\n", + "example": 593, + "start_line": 8747, + "end_line": 8753, + "section": "Images" + }, + { + "markdown": "\n", + "html": "

http://foo.bar.baz

\n", + "example": 594, + "start_line": 8780, + "end_line": 8784, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

https://foo.bar.baz/test?q=hello&id=22&boolean

\n", + "example": 595, + "start_line": 8787, + "end_line": 8791, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

irc://foo.bar:2233/baz

\n", + "example": 596, + "start_line": 8794, + "end_line": 8798, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

MAILTO:FOO@BAR.BAZ

\n", + "example": 597, + "start_line": 8803, + "end_line": 8807, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

a+b+c:d

\n", + "example": 598, + "start_line": 8815, + "end_line": 8819, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

made-up-scheme://foo,bar

\n", + "example": 599, + "start_line": 8822, + "end_line": 8826, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

https://../

\n", + "example": 600, + "start_line": 8829, + "end_line": 8833, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

localhost:5001/foo

\n", + "example": 601, + "start_line": 8836, + "end_line": 8840, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

<https://foo.bar/baz bim>

\n", + "example": 602, + "start_line": 8845, + "end_line": 8849, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

https://example.com/\\[\\

\n", + "example": 603, + "start_line": 8854, + "end_line": 8858, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

foo@bar.example.com

\n", + "example": 604, + "start_line": 8876, + "end_line": 8880, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

foo+special@Bar.baz-bar0.com

\n", + "example": 605, + "start_line": 8883, + "end_line": 8887, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

<foo+@bar.example.com>

\n", + "example": 606, + "start_line": 8892, + "end_line": 8896, + "section": "Autolinks" + }, + { + "markdown": "<>\n", + "html": "

<>

\n", + "example": 607, + "start_line": 8901, + "end_line": 8905, + "section": "Autolinks" + }, + { + "markdown": "< https://foo.bar >\n", + "html": "

< https://foo.bar >

\n", + "example": 608, + "start_line": 8908, + "end_line": 8912, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

<m:abc>

\n", + "example": 609, + "start_line": 8915, + "end_line": 8919, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

<foo.bar.baz>

\n", + "example": 610, + "start_line": 8922, + "end_line": 8926, + "section": "Autolinks" + }, + { + "markdown": "https://example.com\n", + "html": "

https://example.com

\n", + "example": 611, + "start_line": 8929, + "end_line": 8933, + "section": "Autolinks" + }, + { + "markdown": "foo@bar.example.com\n", + "html": "

foo@bar.example.com

\n", + "example": 612, + "start_line": 8936, + "end_line": 8940, + "section": "Autolinks" + }, + { + "markdown": "\n", + "html": "

\n", + "example": 613, + "start_line": 9016, + "end_line": 9020, + "section": "Raw HTML" + }, + { + "markdown": "\n", + "html": "

\n", + "example": 614, + "start_line": 9025, + "end_line": 9029, + "section": "Raw HTML" + }, + { + "markdown": "\n", + "html": "

\n", + "example": 615, + "start_line": 9034, + "end_line": 9040, + "section": "Raw HTML" + }, + { + "markdown": "\n", + "html": "

\n", + "example": 616, + "start_line": 9045, + "end_line": 9051, + "section": "Raw HTML" + }, + { + "markdown": "Foo \n", + "html": "

Foo

\n", + "example": 617, + "start_line": 9056, + "end_line": 9060, + "section": "Raw HTML" + }, + { + "markdown": "<33> <__>\n", + "html": "

<33> <__>

\n", + "example": 618, + "start_line": 9065, + "end_line": 9069, + "section": "Raw HTML" + }, + { + "markdown": "
\n", + "html": "

<a h*#ref="hi">

\n", + "example": 619, + "start_line": 9074, + "end_line": 9078, + "section": "Raw HTML" + }, + { + "markdown": "
\n", + "html": "

<a href="hi'> <a href=hi'>

\n", + "example": 620, + "start_line": 9083, + "end_line": 9087, + "section": "Raw HTML" + }, + { + "markdown": "< a><\nfoo>\n\n", + "html": "

< a><\nfoo><bar/ >\n<foo bar=baz\nbim!bop />

\n", + "example": 621, + "start_line": 9092, + "end_line": 9102, + "section": "Raw HTML" + }, + { + "markdown": "
\n", + "html": "

<a href='bar'title=title>

\n", + "example": 622, + "start_line": 9107, + "end_line": 9111, + "section": "Raw HTML" + }, + { + "markdown": "
\n", + "html": "

\n", + "example": 623, + "start_line": 9116, + "end_line": 9120, + "section": "Raw HTML" + }, + { + "markdown": "\n", + "html": "

</a href="foo">

\n", + "example": 624, + "start_line": 9125, + "end_line": 9129, + "section": "Raw HTML" + }, + { + "markdown": "foo \n", + "html": "

foo

\n", + "example": 625, + "start_line": 9134, + "end_line": 9140, + "section": "Raw HTML" + }, + { + "markdown": "foo foo -->\n\nfoo foo -->\n", + "html": "

foo foo -->

\n

foo foo -->

\n", + "example": 626, + "start_line": 9142, + "end_line": 9149, + "section": "Raw HTML" + }, + { + "markdown": "foo \n", + "html": "

foo

\n", + "example": 627, + "start_line": 9154, + "end_line": 9158, + "section": "Raw HTML" + }, + { + "markdown": "foo \n", + "html": "

foo

\n", + "example": 628, + "start_line": 9163, + "end_line": 9167, + "section": "Raw HTML" + }, + { + "markdown": "foo &<]]>\n", + "html": "

foo &<]]>

\n", + "example": 629, + "start_line": 9172, + "end_line": 9176, + "section": "Raw HTML" + }, + { + "markdown": "foo \n", + "html": "

foo

\n", + "example": 630, + "start_line": 9182, + "end_line": 9186, + "section": "Raw HTML" + }, + { + "markdown": "foo \n", + "html": "

foo

\n", + "example": 631, + "start_line": 9191, + "end_line": 9195, + "section": "Raw HTML" + }, + { + "markdown": "\n", + "html": "

<a href=""">

\n", + "example": 632, + "start_line": 9198, + "end_line": 9202, + "section": "Raw HTML" + }, + { + "markdown": "foo \nbaz\n", + "html": "

foo
\nbaz

\n", + "example": 633, + "start_line": 9212, + "end_line": 9218, + "section": "Hard line breaks" + }, + { + "markdown": "foo\\\nbaz\n", + "html": "

foo
\nbaz

\n", + "example": 634, + "start_line": 9224, + "end_line": 9230, + "section": "Hard line breaks" + }, + { + "markdown": "foo \nbaz\n", + "html": "

foo
\nbaz

\n", + "example": 635, + "start_line": 9235, + "end_line": 9241, + "section": "Hard line breaks" + }, + { + "markdown": "foo \n bar\n", + "html": "

foo
\nbar

\n", + "example": 636, + "start_line": 9246, + "end_line": 9252, + "section": "Hard line breaks" + }, + { + "markdown": "foo\\\n bar\n", + "html": "

foo
\nbar

\n", + "example": 637, + "start_line": 9255, + "end_line": 9261, + "section": "Hard line breaks" + }, + { + "markdown": "*foo \nbar*\n", + "html": "

foo
\nbar

\n", + "example": 638, + "start_line": 9267, + "end_line": 9273, + "section": "Hard line breaks" + }, + { + "markdown": "*foo\\\nbar*\n", + "html": "

foo
\nbar

\n", + "example": 639, + "start_line": 9276, + "end_line": 9282, + "section": "Hard line breaks" + }, + { + "markdown": "`code \nspan`\n", + "html": "

code span

\n", + "example": 640, + "start_line": 9287, + "end_line": 9292, + "section": "Hard line breaks" + }, + { + "markdown": "`code\\\nspan`\n", + "html": "

code\\ span

\n", + "example": 641, + "start_line": 9295, + "end_line": 9300, + "section": "Hard line breaks" + }, + { + "markdown": "
\n", + "html": "

\n", + "example": 642, + "start_line": 9305, + "end_line": 9311, + "section": "Hard line breaks" + }, + { + "markdown": "\n", + "html": "

\n", + "example": 643, + "start_line": 9314, + "end_line": 9320, + "section": "Hard line breaks" + }, + { + "markdown": "foo\\\n", + "html": "

foo\\

\n", + "example": 644, + "start_line": 9327, + "end_line": 9331, + "section": "Hard line breaks" + }, + { + "markdown": "foo \n", + "html": "

foo

\n", + "example": 645, + "start_line": 9334, + "end_line": 9338, + "section": "Hard line breaks" + }, + { + "markdown": "### foo\\\n", + "html": "

foo\\

\n", + "example": 646, + "start_line": 9341, + "end_line": 9345, + "section": "Hard line breaks" + }, + { + "markdown": "### foo \n", + "html": "

foo

\n", + "example": 647, + "start_line": 9348, + "end_line": 9352, + "section": "Hard line breaks" + }, + { + "markdown": "foo\nbaz\n", + "html": "

foo\nbaz

\n", + "example": 648, + "start_line": 9363, + "end_line": 9369, + "section": "Soft line breaks" + }, + { + "markdown": "foo \n baz\n", + "html": "

foo\nbaz

\n", + "example": 649, + "start_line": 9375, + "end_line": 9381, + "section": "Soft line breaks" + }, + { + "markdown": "hello $.;'there\n", + "html": "

hello $.;'there

\n", + "example": 650, + "start_line": 9395, + "end_line": 9399, + "section": "Textual content" + }, + { + "markdown": "Foo χρῆν\n", + "html": "

Foo χρῆν

\n", + "example": 651, + "start_line": 9402, + "end_line": 9406, + "section": "Textual content" + }, + { + "markdown": "Multiple spaces\n", + "html": "

Multiple spaces

\n", + "example": 652, + "start_line": 9411, + "end_line": 9415, + "section": "Textual content" + } +] \ No newline at end of file diff --git a/_tools/gen-emb-structs.go b/_tools/gen-emb-structs.go new file mode 100644 index 0000000..e9cf5b0 --- /dev/null +++ b/_tools/gen-emb-structs.go @@ -0,0 +1,143 @@ +package main + +import ( + "encoding/json" + "flag" + "fmt" + "os" + "path/filepath" + "strings" +) + +func embStructsSubCommand(args []string) { + cmdName := "emb-structs" + cmd := flag.NewFlagSet(cmdName, flag.ExitOnError) + cmd.Usage = func() { + _, _ = fmt.Fprintf(cmd.Output(), `Usage of %s: + + Embed Go structs as compact format in the binary. + JSON file format: + { + "prefix": "html5entities", // prefix for the generated const/var + "types": { // struct field types + "Name": "string", // struct fields + "CodePoints": "[]int", + "Characters": "[]byte" + }, + + // array of struct data + // all data must be a string + "data": [ + {"Name": "AElig", "CodePoints": ["198"], "Characters": ["0xc3", "0x86"]}, + {"Name": "AMP", "CodePoints": ["38"], "Characters": ["0x26"]}, + ] + } + +`, cmdName) + cmd.PrintDefaults() + } + + inputJSONPath := cmd.String("i", "", "source JSON file path(required)") + outputPath := cmd.String("o", "", "output file path(required)") + + if err := cmd.Parse(args); err != nil || + len(*inputJSONPath) == 0 || + len(*outputPath) == 0 { + usage(cmd.Usage, err) + } + var source map[string]any + inputJSONSource, err := os.ReadFile(*inputJSONPath) + if err != nil { + panic(err) + } + if err := json.Unmarshal(inputJSONSource, &source); err != nil { + panic(err) + } + + f, err := os.Create(*outputPath) + if err != nil { + fmt.Printf("Failed to open %s: %v\n", *outputPath, err) + os.Exit(1) + } + defer f.Close() + + abs, _ := filepath.Abs(*outputPath) + pkg := filepath.Base(filepath.Dir(abs)) + + write := func(ft string, v ...any) { + if len(v) == 0 { + _, _ = f.WriteString(ft) + return + } + _, _ = f.WriteString(fmt.Sprintf(ft, v...)) + } + writeln := func(ft string, v ...any) { + write(ft+"\n", v...) + } + + writeln("// Code generated by _tools; DO NOT EDIT.") + writeln("package " + pkg) + + prefix := source["prefix"].(string) + types := source["types"].(map[string]any) + data := source["data"].([]any) + + writeln("const _%sLength = %d", prefix, len(data)) + + for prop, _typ := range types { + typ := _typ.(string) + if typ == "string" { + write("const _%s%s string = \"", prefix, prop) + for _, _d := range data { + d := _d.(map[string]any) + v := d[prop].(string) + write(v) + } + writeln(`"`) + write("const _%s%sIndex = \"", prefix, prop) + for _, _d := range data { + d := _d.(map[string]any) + v := d[prop].(string) + write("\\x%02x", len(v)) + } + writeln(`"`) + continue + } + + if strings.HasPrefix(typ, "[]") { + elmTyp := typ[2:] + write("var _%s%s = [...]%s{", prefix, prop, elmTyp) + for i, _d := range data { + d := _d.(map[string]any) + arr := d[prop].([]any) + for j, a := range arr { + v := a.(string) + write(v) + if i != len(data)-1 || j != len(arr)-1 { + write(", ") + } + } + } + writeln("}") + write("var _%s%sIndex = \"", prefix, prop) + for _, _d := range data { + d := _d.(map[string]any) + arr := d[prop].([]any) + write("\\x%02x", len(arr)) + } + writeln(`"`) + continue + } + + write("var _%s%s = [...]%s{", prefix, prop, typ) + for i, _d := range data { + d := _d.(map[string]any) + v := d[prop].(string) + write(v) + if i != len(data)-1 { + write(", ") + } + } + writeln(`}`) + } +} diff --git a/_tools/gen-oss-fuzz-corpus.go b/_tools/gen-oss-fuzz-corpus.go new file mode 100644 index 0000000..5037a6b --- /dev/null +++ b/_tools/gen-oss-fuzz-corpus.go @@ -0,0 +1,61 @@ +package main + +import ( + "archive/zip" + "encoding/json" + "io/ioutil" + "log" + "os" + "strconv" + "strings" +) + +type TestCase struct { + Example int `json:"example"` + Markdown string `json:"markdown"` +} + +func ossFuzzCorpusSubCommand(args []string) { + corpus_out := args[0] + if !strings.HasSuffix(corpus_out, ".zip") { + log.Fatalln("Expected command line:", os.Args[0], ".zip") + } + + zip_file, err := os.Create(corpus_out) + + zip_writer := zip.NewWriter(zip_file) + + if err != nil { + log.Fatalln("Failed creating file:", err) + } + + json_corpus := "_test/spec.json" + bs, err := ioutil.ReadFile(json_corpus) + if err != nil { + log.Fatalln("Could not open file:", json_corpus) + panic(err) + } + var testCases []TestCase + if err := json.Unmarshal(bs, &testCases); err != nil { + panic(err) + } + + for _, c := range testCases { + file_in_zip := "example-" + strconv.Itoa(c.Example) + f, err := zip_writer.Create(file_in_zip) + if err != nil { + log.Fatal(err) + } + _, err = f.Write([]byte(c.Markdown)) + if err != nil { + log.Fatalf("Failed to write file: %s into zip file", file_in_zip) + } + } + + err = zip_writer.Close() + if err != nil { + log.Fatal("Failed to close zip writer", err) + } + + zip_file.Close() +} diff --git a/_tools/gen-unicode-case-folding-map.go b/_tools/gen-unicode-case-folding-map.go new file mode 100644 index 0000000..eb0d401 --- /dev/null +++ b/_tools/gen-unicode-case-folding-map.go @@ -0,0 +1,108 @@ +package main + +import ( + "bufio" + "bytes" + "encoding/json" + "flag" + "fmt" + "io" + "net/http" + "os" + "strconv" + "strings" +) + +type caseFolding struct { + Class byte + From rune + To []rune +} + +func unicodeCaseFoldingMapSubCommand(args []string) { + cmdName := "unicode-case-folding-map" + cmd := flag.NewFlagSet(cmdName, flag.ExitOnError) + cmd.Usage = func() { + _, _ = fmt.Fprintf(cmd.Output(), `Usage of %s: + + Generate input JSON data for emb-structs subcommand from unicode.org + +`, cmdName) + cmd.PrintDefaults() + } + + outputPath := cmd.String("o", "", "output file path(required)") + unicodeVersion := cmd.String("u", "15.0.0", "unicode version") + + if err := cmd.Parse(args); err != nil || + len(*outputPath) == 0 { + usage(cmd.Usage, err) + } + + url := "http://www.unicode.org/Public/" + *unicodeVersion + "/ucd/CaseFolding.txt" + + resp, err := http.Get(url) + if err != nil { + fmt.Printf("Failed to get CaseFolding.txt: %v\n", err) + os.Exit(1) + } + defer resp.Body.Close() + + bs, err := io.ReadAll(resp.Body) + if err != nil { + fmt.Printf("Failed to get CaseFolding.txt: %v\n", err) + os.Exit(1) + } + + buf := bytes.NewBuffer(bs) + scanner := bufio.NewScanner(buf) + + embstructmap := make(map[string]any) + embstructmap["prefix"] = "unicodeCaseFolding" + embstructmap["types"] = map[string]any{ + "From": "rune", + "To": "[]rune", + } + var data []any + + for scanner.Scan() { + line := scanner.Text() + if strings.HasPrefix(line, "#") || len(strings.TrimSpace(line)) == 0 { + continue + } + line = strings.Split(line, "#")[0] + parts := strings.Split(line, ";") + for i, p := range parts { + parts[i] = strings.TrimSpace(p) + } + cf := caseFolding{} + v, _ := strconv.ParseInt(parts[0], 16, 32) + cf.From = rune(int32(v)) + cf.Class = parts[1][0] + for _, v := range strings.Split(parts[2], " ") { + c, _ := strconv.ParseInt(v, 16, 32) + cf.To = append(cf.To, rune(int32(c))) + } + if cf.Class != 'C' && cf.Class != 'F' { + continue + } + var tos []string + for _, v := range cf.To { + tos = append(tos, fmt.Sprintf("%d", v)) + } + data = append(data, map[string]any{ + "From": fmt.Sprintf("0x%x", cf.From), + "To": tos, + }) + } + embstructmap["data"] = data + jsonData, err := json.MarshalIndent(embstructmap, "", " ") + if err != nil { + panic(err) + } + err = os.WriteFile(*outputPath, jsonData, 0644) + if err != nil { + panic(err) + } + +} diff --git a/_tools/html5entities.json b/_tools/html5entities.json new file mode 100644 index 0000000..d4c276f --- /dev/null +++ b/_tools/html5entities.json @@ -0,0 +1,2133 @@ +{ + "prefix": "html5entities", + "types": { + "Name": "string", + "Characters": "[]byte" + }, + "data": [ + {"Name": "AElig", "Characters": ["0xc3", "0x86"]}, + {"Name": "AMP", "Characters": ["0x26"]}, + {"Name": "Aacute", "Characters": ["0xc3", "0x81"]}, + {"Name": "Acirc", "Characters": ["0xc3", "0x82"]}, + {"Name": "Acy", "Characters": ["0xd0", "0x90"]}, + {"Name": "Afr", "Characters": ["0xf0", "0x9d", "0x94", "0x84"]}, + {"Name": "Agrave", "Characters": ["0xc3", "0x80"]}, + {"Name": "Alpha", "Characters": ["0xce", "0x91"]}, + {"Name": "Amacr", "Characters": ["0xc4", "0x80"]}, + {"Name": "And", "Characters": ["0xe2", "0xa9", "0x93"]}, + {"Name": "Aogon", "Characters": ["0xc4", "0x84"]}, + {"Name": "Aopf", "Characters": ["0xf0", "0x9d", "0x94", "0xb8"]}, + {"Name": "ApplyFunction", "Characters": ["0xe2", "0x81", "0xa1"]}, + {"Name": "Aring", "Characters": ["0xc3", "0x85"]}, + {"Name": "Ascr", "Characters": ["0xf0", "0x9d", "0x92", "0x9c"]}, + {"Name": "Assign", "Characters": ["0xe2", "0x89", "0x94"]}, + {"Name": "Atilde", "Characters": ["0xc3", "0x83"]}, + {"Name": "Auml", "Characters": ["0xc3", "0x84"]}, + {"Name": "Backslash", "Characters": ["0xe2", "0x88", "0x96"]}, + {"Name": "Barv", "Characters": ["0xe2", "0xab", "0xa7"]}, + {"Name": "Barwed", "Characters": ["0xe2", "0x8c", "0x86"]}, + {"Name": "Bcy", "Characters": ["0xd0", "0x91"]}, + {"Name": "Because", "Characters": ["0xe2", "0x88", "0xb5"]}, + {"Name": "Bernoullis", "Characters": ["0xe2", "0x84", "0xac"]}, + {"Name": "Beta", "Characters": ["0xce", "0x92"]}, + {"Name": "Bfr", "Characters": ["0xf0", "0x9d", "0x94", "0x85"]}, + {"Name": "Bopf", "Characters": ["0xf0", "0x9d", "0x94", "0xb9"]}, + {"Name": "Breve", "Characters": ["0xcb", "0x98"]}, + {"Name": "Bscr", "Characters": ["0xe2", "0x84", "0xac"]}, + {"Name": "Bumpeq", "Characters": ["0xe2", "0x89", "0x8e"]}, + {"Name": "CHcy", "Characters": ["0xd0", "0xa7"]}, + {"Name": "COPY", "Characters": ["0xc2", "0xa9"]}, + {"Name": "Cacute", "Characters": ["0xc4", "0x86"]}, + {"Name": "Cap", "Characters": ["0xe2", "0x8b", "0x92"]}, + {"Name": "CapitalDifferentialD", "Characters": ["0xe2", "0x85", "0x85"]}, + {"Name": "Cayleys", "Characters": ["0xe2", "0x84", "0xad"]}, + {"Name": "Ccaron", "Characters": ["0xc4", "0x8c"]}, + {"Name": "Ccedil", "Characters": ["0xc3", "0x87"]}, + {"Name": "Ccirc", "Characters": ["0xc4", "0x88"]}, + {"Name": "Cconint", "Characters": ["0xe2", "0x88", "0xb0"]}, + {"Name": "Cdot", "Characters": ["0xc4", "0x8a"]}, + {"Name": "Cedilla", "Characters": ["0xc2", "0xb8"]}, + {"Name": "CenterDot", "Characters": ["0xc2", "0xb7"]}, + {"Name": "Cfr", "Characters": ["0xe2", "0x84", "0xad"]}, + {"Name": "Chi", "Characters": ["0xce", "0xa7"]}, + {"Name": "CircleDot", "Characters": ["0xe2", "0x8a", "0x99"]}, + {"Name": "CircleMinus", "Characters": ["0xe2", "0x8a", "0x96"]}, + {"Name": "CirclePlus", "Characters": ["0xe2", "0x8a", "0x95"]}, + {"Name": "CircleTimes", "Characters": ["0xe2", "0x8a", "0x97"]}, + {"Name": "ClockwiseContourIntegral", "Characters": ["0xe2", "0x88", "0xb2"]}, + {"Name": "CloseCurlyDoubleQuote", "Characters": ["0xe2", "0x80", "0x9d"]}, + {"Name": "CloseCurlyQuote", "Characters": ["0xe2", "0x80", "0x99"]}, + {"Name": "Colon", "Characters": ["0xe2", "0x88", "0xb7"]}, + {"Name": "Colone", "Characters": ["0xe2", "0xa9", "0xb4"]}, + {"Name": "Congruent", "Characters": ["0xe2", "0x89", "0xa1"]}, + {"Name": "Conint", "Characters": ["0xe2", "0x88", "0xaf"]}, + {"Name": "ContourIntegral", "Characters": ["0xe2", "0x88", "0xae"]}, + {"Name": "Copf", "Characters": ["0xe2", "0x84", "0x82"]}, + {"Name": "Coproduct", "Characters": ["0xe2", "0x88", "0x90"]}, + {"Name": "CounterClockwiseContourIntegral", "Characters": ["0xe2", "0x88", "0xb3"]}, + {"Name": "Cross", "Characters": ["0xe2", "0xa8", "0xaf"]}, + {"Name": "Cscr", "Characters": ["0xf0", "0x9d", "0x92", "0x9e"]}, + {"Name": "Cup", "Characters": ["0xe2", "0x8b", "0x93"]}, + {"Name": "CupCap", "Characters": ["0xe2", "0x89", "0x8d"]}, + {"Name": "DD", "Characters": ["0xe2", "0x85", "0x85"]}, + {"Name": "DDotrahd", "Characters": ["0xe2", "0xa4", "0x91"]}, + {"Name": "DJcy", "Characters": ["0xd0", "0x82"]}, + {"Name": "DScy", "Characters": ["0xd0", "0x85"]}, + {"Name": "DZcy", "Characters": ["0xd0", "0x8f"]}, + {"Name": "Dagger", "Characters": ["0xe2", "0x80", "0xa1"]}, + {"Name": "Darr", "Characters": ["0xe2", "0x86", "0xa1"]}, + {"Name": "Dashv", "Characters": ["0xe2", "0xab", "0xa4"]}, + {"Name": "Dcaron", "Characters": ["0xc4", "0x8e"]}, + {"Name": "Dcy", "Characters": ["0xd0", "0x94"]}, + {"Name": "Del", "Characters": ["0xe2", "0x88", "0x87"]}, + {"Name": "Delta", "Characters": ["0xce", "0x94"]}, + {"Name": "Dfr", "Characters": ["0xf0", "0x9d", "0x94", "0x87"]}, + {"Name": "DiacriticalAcute", "Characters": ["0xc2", "0xb4"]}, + {"Name": "DiacriticalDot", "Characters": ["0xcb", "0x99"]}, + {"Name": "DiacriticalDoubleAcute", "Characters": ["0xcb", "0x9d"]}, + {"Name": "DiacriticalGrave", "Characters": ["0x60"]}, + {"Name": "DiacriticalTilde", "Characters": ["0xcb", "0x9c"]}, + {"Name": "Diamond", "Characters": ["0xe2", "0x8b", "0x84"]}, + {"Name": "DifferentialD", "Characters": ["0xe2", "0x85", "0x86"]}, + {"Name": "Dopf", "Characters": ["0xf0", "0x9d", "0x94", "0xbb"]}, + {"Name": "Dot", "Characters": ["0xc2", "0xa8"]}, + {"Name": "DotDot", "Characters": ["0xe2", "0x83", "0x9c"]}, + {"Name": "DotEqual", "Characters": ["0xe2", "0x89", "0x90"]}, + {"Name": "DoubleContourIntegral", "Characters": ["0xe2", "0x88", "0xaf"]}, + {"Name": "DoubleDot", "Characters": ["0xc2", "0xa8"]}, + {"Name": "DoubleDownArrow", "Characters": ["0xe2", "0x87", "0x93"]}, + {"Name": "DoubleLeftArrow", "Characters": ["0xe2", "0x87", "0x90"]}, + {"Name": "DoubleLeftRightArrow", "Characters": ["0xe2", "0x87", "0x94"]}, + {"Name": "DoubleLeftTee", "Characters": ["0xe2", "0xab", "0xa4"]}, + {"Name": "DoubleLongLeftArrow", "Characters": ["0xe2", "0x9f", "0xb8"]}, + {"Name": "DoubleLongLeftRightArrow", "Characters": ["0xe2", "0x9f", "0xba"]}, + {"Name": "DoubleLongRightArrow", "Characters": ["0xe2", "0x9f", "0xb9"]}, + {"Name": "DoubleRightArrow", "Characters": ["0xe2", "0x87", "0x92"]}, + {"Name": "DoubleRightTee", "Characters": ["0xe2", "0x8a", "0xa8"]}, + {"Name": "DoubleUpArrow", "Characters": ["0xe2", "0x87", "0x91"]}, + {"Name": "DoubleUpDownArrow", "Characters": ["0xe2", "0x87", "0x95"]}, + {"Name": "DoubleVerticalBar", "Characters": ["0xe2", "0x88", "0xa5"]}, + {"Name": "DownArrow", "Characters": ["0xe2", "0x86", "0x93"]}, + {"Name": "DownArrowBar", "Characters": ["0xe2", "0xa4", "0x93"]}, + {"Name": "DownArrowUpArrow", "Characters": ["0xe2", "0x87", "0xb5"]}, + {"Name": "DownBreve", "Characters": ["0xcc", "0x91"]}, + {"Name": "DownLeftRightVector", "Characters": ["0xe2", "0xa5", "0x90"]}, + {"Name": "DownLeftTeeVector", "Characters": ["0xe2", "0xa5", "0x9e"]}, + {"Name": "DownLeftVector", "Characters": ["0xe2", "0x86", "0xbd"]}, + {"Name": "DownLeftVectorBar", "Characters": ["0xe2", "0xa5", "0x96"]}, + {"Name": "DownRightTeeVector", "Characters": ["0xe2", "0xa5", "0x9f"]}, + {"Name": "DownRightVector", "Characters": ["0xe2", "0x87", "0x81"]}, + {"Name": "DownRightVectorBar", "Characters": ["0xe2", "0xa5", "0x97"]}, + {"Name": "DownTee", "Characters": ["0xe2", "0x8a", "0xa4"]}, + {"Name": "DownTeeArrow", "Characters": ["0xe2", "0x86", "0xa7"]}, + {"Name": "Downarrow", "Characters": ["0xe2", "0x87", "0x93"]}, + {"Name": "Dscr", "Characters": ["0xf0", "0x9d", "0x92", "0x9f"]}, + {"Name": "Dstrok", "Characters": ["0xc4", "0x90"]}, + {"Name": "ENG", "Characters": ["0xc5", "0x8a"]}, + {"Name": "ETH", "Characters": ["0xc3", "0x90"]}, + {"Name": "Eacute", "Characters": ["0xc3", "0x89"]}, + {"Name": "Ecaron", "Characters": ["0xc4", "0x9a"]}, + {"Name": "Ecirc", "Characters": ["0xc3", "0x8a"]}, + {"Name": "Ecy", "Characters": ["0xd0", "0xad"]}, + {"Name": "Edot", "Characters": ["0xc4", "0x96"]}, + {"Name": "Efr", "Characters": ["0xf0", "0x9d", "0x94", "0x88"]}, + {"Name": "Egrave", "Characters": ["0xc3", "0x88"]}, + {"Name": "Element", "Characters": ["0xe2", "0x88", "0x88"]}, + {"Name": "Emacr", "Characters": ["0xc4", "0x92"]}, + {"Name": "EmptySmallSquare", "Characters": ["0xe2", "0x97", "0xbb"]}, + {"Name": "EmptyVerySmallSquare", "Characters": ["0xe2", "0x96", "0xab"]}, + {"Name": "Eogon", "Characters": ["0xc4", "0x98"]}, + {"Name": "Eopf", "Characters": ["0xf0", "0x9d", "0x94", "0xbc"]}, + {"Name": "Epsilon", "Characters": ["0xce", "0x95"]}, + {"Name": "Equal", "Characters": ["0xe2", "0xa9", "0xb5"]}, + {"Name": "EqualTilde", "Characters": ["0xe2", "0x89", "0x82"]}, + {"Name": "Equilibrium", "Characters": ["0xe2", "0x87", "0x8c"]}, + {"Name": "Escr", "Characters": ["0xe2", "0x84", "0xb0"]}, + {"Name": "Esim", "Characters": ["0xe2", "0xa9", "0xb3"]}, + {"Name": "Eta", "Characters": ["0xce", "0x97"]}, + {"Name": "Euml", "Characters": ["0xc3", "0x8b"]}, + {"Name": "Exists", "Characters": ["0xe2", "0x88", "0x83"]}, + {"Name": "ExponentialE", "Characters": ["0xe2", "0x85", "0x87"]}, + {"Name": "Fcy", "Characters": ["0xd0", "0xa4"]}, + {"Name": "Ffr", "Characters": ["0xf0", "0x9d", "0x94", "0x89"]}, + {"Name": "FilledSmallSquare", "Characters": ["0xe2", "0x97", "0xbc"]}, + {"Name": "FilledVerySmallSquare", "Characters": ["0xe2", "0x96", "0xaa"]}, + {"Name": "Fopf", "Characters": ["0xf0", "0x9d", "0x94", "0xbd"]}, + {"Name": "ForAll", "Characters": ["0xe2", "0x88", "0x80"]}, + {"Name": "Fouriertrf", "Characters": ["0xe2", "0x84", "0xb1"]}, + {"Name": "Fscr", "Characters": ["0xe2", "0x84", "0xb1"]}, + {"Name": "GJcy", "Characters": ["0xd0", "0x83"]}, + {"Name": "GT", "Characters": ["0x3e"]}, + {"Name": "Gamma", "Characters": ["0xce", "0x93"]}, + {"Name": "Gammad", "Characters": ["0xcf", "0x9c"]}, + {"Name": "Gbreve", "Characters": ["0xc4", "0x9e"]}, + {"Name": "Gcedil", "Characters": ["0xc4", "0xa2"]}, + {"Name": "Gcirc", "Characters": ["0xc4", "0x9c"]}, + {"Name": "Gcy", "Characters": ["0xd0", "0x93"]}, + {"Name": "Gdot", "Characters": ["0xc4", "0xa0"]}, + {"Name": "Gfr", "Characters": ["0xf0", "0x9d", "0x94", "0x8a"]}, + {"Name": "Gg", "Characters": ["0xe2", "0x8b", "0x99"]}, + {"Name": "Gopf", "Characters": ["0xf0", "0x9d", "0x94", "0xbe"]}, + {"Name": "GreaterEqual", "Characters": ["0xe2", "0x89", "0xa5"]}, + {"Name": "GreaterEqualLess", "Characters": ["0xe2", "0x8b", "0x9b"]}, + {"Name": "GreaterFullEqual", "Characters": ["0xe2", "0x89", "0xa7"]}, + {"Name": "GreaterGreater", "Characters": ["0xe2", "0xaa", "0xa2"]}, + {"Name": "GreaterLess", "Characters": ["0xe2", "0x89", "0xb7"]}, + {"Name": "GreaterSlantEqual", "Characters": ["0xe2", "0xa9", "0xbe"]}, + {"Name": "GreaterTilde", "Characters": ["0xe2", "0x89", "0xb3"]}, + {"Name": "Gscr", "Characters": ["0xf0", "0x9d", "0x92", "0xa2"]}, + {"Name": "Gt", "Characters": ["0xe2", "0x89", "0xab"]}, + {"Name": "HARDcy", "Characters": ["0xd0", "0xaa"]}, + {"Name": "Hacek", "Characters": ["0xcb", "0x87"]}, + {"Name": "Hat", "Characters": ["0x5e"]}, + {"Name": "Hcirc", "Characters": ["0xc4", "0xa4"]}, + {"Name": "Hfr", "Characters": ["0xe2", "0x84", "0x8c"]}, + {"Name": "HilbertSpace", "Characters": ["0xe2", "0x84", "0x8b"]}, + {"Name": "Hopf", "Characters": ["0xe2", "0x84", "0x8d"]}, + {"Name": "HorizontalLine", "Characters": ["0xe2", "0x94", "0x80"]}, + {"Name": "Hscr", "Characters": ["0xe2", "0x84", "0x8b"]}, + {"Name": "Hstrok", "Characters": ["0xc4", "0xa6"]}, + {"Name": "HumpDownHump", "Characters": ["0xe2", "0x89", "0x8e"]}, + {"Name": "HumpEqual", "Characters": ["0xe2", "0x89", "0x8f"]}, + {"Name": "IEcy", "Characters": ["0xd0", "0x95"]}, + {"Name": "IJlig", "Characters": ["0xc4", "0xb2"]}, + {"Name": "IOcy", "Characters": ["0xd0", "0x81"]}, + {"Name": "Iacute", "Characters": ["0xc3", "0x8d"]}, + {"Name": "Icirc", "Characters": ["0xc3", "0x8e"]}, + {"Name": "Icy", "Characters": ["0xd0", "0x98"]}, + {"Name": "Idot", "Characters": ["0xc4", "0xb0"]}, + {"Name": "Ifr", "Characters": ["0xe2", "0x84", "0x91"]}, + {"Name": "Igrave", "Characters": ["0xc3", "0x8c"]}, + {"Name": "Im", "Characters": ["0xe2", "0x84", "0x91"]}, + {"Name": "Imacr", "Characters": ["0xc4", "0xaa"]}, + {"Name": "ImaginaryI", "Characters": ["0xe2", "0x85", "0x88"]}, + {"Name": "Implies", "Characters": ["0xe2", "0x87", "0x92"]}, + {"Name": "Int", "Characters": ["0xe2", "0x88", "0xac"]}, + {"Name": "Integral", "Characters": ["0xe2", "0x88", "0xab"]}, + {"Name": "Intersection", "Characters": ["0xe2", "0x8b", "0x82"]}, + {"Name": "InvisibleComma", "Characters": ["0xe2", "0x81", "0xa3"]}, + {"Name": "InvisibleTimes", "Characters": ["0xe2", "0x81", "0xa2"]}, + {"Name": "Iogon", "Characters": ["0xc4", "0xae"]}, + {"Name": "Iopf", "Characters": ["0xf0", "0x9d", "0x95", "0x80"]}, + {"Name": "Iota", "Characters": ["0xce", "0x99"]}, + {"Name": "Iscr", "Characters": ["0xe2", "0x84", "0x90"]}, + {"Name": "Itilde", "Characters": ["0xc4", "0xa8"]}, + {"Name": "Iukcy", "Characters": ["0xd0", "0x86"]}, + {"Name": "Iuml", "Characters": ["0xc3", "0x8f"]}, + {"Name": "Jcirc", "Characters": ["0xc4", "0xb4"]}, + {"Name": "Jcy", "Characters": ["0xd0", "0x99"]}, + {"Name": "Jfr", "Characters": ["0xf0", "0x9d", "0x94", "0x8d"]}, + {"Name": "Jopf", "Characters": ["0xf0", "0x9d", "0x95", "0x81"]}, + {"Name": "Jscr", "Characters": ["0xf0", "0x9d", "0x92", "0xa5"]}, + {"Name": "Jsercy", "Characters": ["0xd0", "0x88"]}, + {"Name": "Jukcy", "Characters": ["0xd0", "0x84"]}, + {"Name": "KHcy", "Characters": ["0xd0", "0xa5"]}, + {"Name": "KJcy", "Characters": ["0xd0", "0x8c"]}, + {"Name": "Kappa", "Characters": ["0xce", "0x9a"]}, + {"Name": "Kcedil", "Characters": ["0xc4", "0xb6"]}, + {"Name": "Kcy", "Characters": ["0xd0", "0x9a"]}, + {"Name": "Kfr", "Characters": ["0xf0", "0x9d", "0x94", "0x8e"]}, + {"Name": "Kopf", "Characters": ["0xf0", "0x9d", "0x95", "0x82"]}, + {"Name": "Kscr", "Characters": ["0xf0", "0x9d", "0x92", "0xa6"]}, + {"Name": "LJcy", "Characters": ["0xd0", "0x89"]}, + {"Name": "LT", "Characters": ["0x3c"]}, + {"Name": "Lacute", "Characters": ["0xc4", "0xb9"]}, + {"Name": "Lambda", "Characters": ["0xce", "0x9b"]}, + {"Name": "Lang", "Characters": ["0xe2", "0x9f", "0xaa"]}, + {"Name": "Laplacetrf", "Characters": ["0xe2", "0x84", "0x92"]}, + {"Name": "Larr", "Characters": ["0xe2", "0x86", "0x9e"]}, + {"Name": "Lcaron", "Characters": ["0xc4", "0xbd"]}, + {"Name": "Lcedil", "Characters": ["0xc4", "0xbb"]}, + {"Name": "Lcy", "Characters": ["0xd0", "0x9b"]}, + {"Name": "LeftAngleBracket", "Characters": ["0xe2", "0x9f", "0xa8"]}, + {"Name": "LeftArrow", "Characters": ["0xe2", "0x86", "0x90"]}, + {"Name": "LeftArrowBar", "Characters": ["0xe2", "0x87", "0xa4"]}, + {"Name": "LeftArrowRightArrow", "Characters": ["0xe2", "0x87", "0x86"]}, + {"Name": "LeftCeiling", "Characters": ["0xe2", "0x8c", "0x88"]}, + {"Name": "LeftDoubleBracket", "Characters": ["0xe2", "0x9f", "0xa6"]}, + {"Name": "LeftDownTeeVector", "Characters": ["0xe2", "0xa5", "0xa1"]}, + {"Name": "LeftDownVector", "Characters": ["0xe2", "0x87", "0x83"]}, + {"Name": "LeftDownVectorBar", "Characters": ["0xe2", "0xa5", "0x99"]}, + {"Name": "LeftFloor", "Characters": ["0xe2", "0x8c", "0x8a"]}, + {"Name": "LeftRightArrow", "Characters": ["0xe2", "0x86", "0x94"]}, + {"Name": "LeftRightVector", "Characters": ["0xe2", "0xa5", "0x8e"]}, + {"Name": "LeftTee", "Characters": ["0xe2", "0x8a", "0xa3"]}, + {"Name": "LeftTeeArrow", "Characters": ["0xe2", "0x86", "0xa4"]}, + {"Name": "LeftTeeVector", "Characters": ["0xe2", "0xa5", "0x9a"]}, + {"Name": "LeftTriangle", "Characters": ["0xe2", "0x8a", "0xb2"]}, + {"Name": "LeftTriangleBar", "Characters": ["0xe2", "0xa7", "0x8f"]}, + {"Name": "LeftTriangleEqual", "Characters": ["0xe2", "0x8a", "0xb4"]}, + {"Name": "LeftUpDownVector", "Characters": ["0xe2", "0xa5", "0x91"]}, + {"Name": "LeftUpTeeVector", "Characters": ["0xe2", "0xa5", "0xa0"]}, + {"Name": "LeftUpVector", "Characters": ["0xe2", "0x86", "0xbf"]}, + {"Name": "LeftUpVectorBar", "Characters": ["0xe2", "0xa5", "0x98"]}, + {"Name": "LeftVector", "Characters": ["0xe2", "0x86", "0xbc"]}, + {"Name": "LeftVectorBar", "Characters": ["0xe2", "0xa5", "0x92"]}, + {"Name": "Leftarrow", "Characters": ["0xe2", "0x87", "0x90"]}, + {"Name": "Leftrightarrow", "Characters": ["0xe2", "0x87", "0x94"]}, + {"Name": "LessEqualGreater", "Characters": ["0xe2", "0x8b", "0x9a"]}, + {"Name": "LessFullEqual", "Characters": ["0xe2", "0x89", "0xa6"]}, + {"Name": "LessGreater", "Characters": ["0xe2", "0x89", "0xb6"]}, + {"Name": "LessLess", "Characters": ["0xe2", "0xaa", "0xa1"]}, + {"Name": "LessSlantEqual", "Characters": ["0xe2", "0xa9", "0xbd"]}, + {"Name": "LessTilde", "Characters": ["0xe2", "0x89", "0xb2"]}, + {"Name": "Lfr", "Characters": ["0xf0", "0x9d", "0x94", "0x8f"]}, + {"Name": "Ll", "Characters": ["0xe2", "0x8b", "0x98"]}, + {"Name": "Lleftarrow", "Characters": ["0xe2", "0x87", "0x9a"]}, + {"Name": "Lmidot", "Characters": ["0xc4", "0xbf"]}, + {"Name": "LongLeftArrow", "Characters": ["0xe2", "0x9f", "0xb5"]}, + {"Name": "LongLeftRightArrow", "Characters": ["0xe2", "0x9f", "0xb7"]}, + {"Name": "LongRightArrow", "Characters": ["0xe2", "0x9f", "0xb6"]}, + {"Name": "Longleftarrow", "Characters": ["0xe2", "0x9f", "0xb8"]}, + {"Name": "Longleftrightarrow", "Characters": ["0xe2", "0x9f", "0xba"]}, + {"Name": "Longrightarrow", "Characters": ["0xe2", "0x9f", "0xb9"]}, + {"Name": "Lopf", "Characters": ["0xf0", "0x9d", "0x95", "0x83"]}, + {"Name": "LowerLeftArrow", "Characters": ["0xe2", "0x86", "0x99"]}, + {"Name": "LowerRightArrow", "Characters": ["0xe2", "0x86", "0x98"]}, + {"Name": "Lscr", "Characters": ["0xe2", "0x84", "0x92"]}, + {"Name": "Lsh", "Characters": ["0xe2", "0x86", "0xb0"]}, + {"Name": "Lstrok", "Characters": ["0xc5", "0x81"]}, + {"Name": "Lt", "Characters": ["0xe2", "0x89", "0xaa"]}, + {"Name": "Map", "Characters": ["0xe2", "0xa4", "0x85"]}, + {"Name": "Mcy", "Characters": ["0xd0", "0x9c"]}, + {"Name": "MediumSpace", "Characters": ["0xe2", "0x81", "0x9f"]}, + {"Name": "Mellintrf", "Characters": ["0xe2", "0x84", "0xb3"]}, + {"Name": "Mfr", "Characters": ["0xf0", "0x9d", "0x94", "0x90"]}, + {"Name": "MinusPlus", "Characters": ["0xe2", "0x88", "0x93"]}, + {"Name": "Mopf", "Characters": ["0xf0", "0x9d", "0x95", "0x84"]}, + {"Name": "Mscr", "Characters": ["0xe2", "0x84", "0xb3"]}, + {"Name": "Mu", "Characters": ["0xce", "0x9c"]}, + {"Name": "NJcy", "Characters": ["0xd0", "0x8a"]}, + {"Name": "Nacute", "Characters": ["0xc5", "0x83"]}, + {"Name": "Ncaron", "Characters": ["0xc5", "0x87"]}, + {"Name": "Ncedil", "Characters": ["0xc5", "0x85"]}, + {"Name": "Ncy", "Characters": ["0xd0", "0x9d"]}, + {"Name": "NegativeMediumSpace", "Characters": ["0xe2", "0x80", "0x8b"]}, + {"Name": "NegativeThickSpace", "Characters": ["0xe2", "0x80", "0x8b"]}, + {"Name": "NegativeThinSpace", "Characters": ["0xe2", "0x80", "0x8b"]}, + {"Name": "NegativeVeryThinSpace", "Characters": ["0xe2", "0x80", "0x8b"]}, + {"Name": "NestedGreaterGreater", "Characters": ["0xe2", "0x89", "0xab"]}, + {"Name": "NestedLessLess", "Characters": ["0xe2", "0x89", "0xaa"]}, + {"Name": "NewLine", "Characters": ["0xa"]}, + {"Name": "Nfr", "Characters": ["0xf0", "0x9d", "0x94", "0x91"]}, + {"Name": "NoBreak", "Characters": ["0xe2", "0x81", "0xa0"]}, + {"Name": "NonBreakingSpace", "Characters": ["0xc2", "0xa0"]}, + {"Name": "Nopf", "Characters": ["0xe2", "0x84", "0x95"]}, + {"Name": "Not", "Characters": ["0xe2", "0xab", "0xac"]}, + {"Name": "NotCongruent", "Characters": ["0xe2", "0x89", "0xa2"]}, + {"Name": "NotCupCap", "Characters": ["0xe2", "0x89", "0xad"]}, + {"Name": "NotDoubleVerticalBar", "Characters": ["0xe2", "0x88", "0xa6"]}, + {"Name": "NotElement", "Characters": ["0xe2", "0x88", "0x89"]}, + {"Name": "NotEqual", "Characters": ["0xe2", "0x89", "0xa0"]}, + {"Name": "NotEqualTilde", "Characters": ["0xe2", "0x89", "0x82", "0xcc", "0xb8"]}, + {"Name": "NotExists", "Characters": ["0xe2", "0x88", "0x84"]}, + {"Name": "NotGreater", "Characters": ["0xe2", "0x89", "0xaf"]}, + {"Name": "NotGreaterEqual", "Characters": ["0xe2", "0x89", "0xb1"]}, + {"Name": "NotGreaterFullEqual", "Characters": ["0xe2", "0x89", "0xa7", "0xcc", "0xb8"]}, + {"Name": "NotGreaterGreater", "Characters": ["0xe2", "0x89", "0xab", "0xcc", "0xb8"]}, + {"Name": "NotGreaterLess", "Characters": ["0xe2", "0x89", "0xb9"]}, + {"Name": "NotGreaterSlantEqual", "Characters": ["0xe2", "0xa9", "0xbe", "0xcc", "0xb8"]}, + {"Name": "NotGreaterTilde", "Characters": ["0xe2", "0x89", "0xb5"]}, + {"Name": "NotHumpDownHump", "Characters": ["0xe2", "0x89", "0x8e", "0xcc", "0xb8"]}, + {"Name": "NotHumpEqual", "Characters": ["0xe2", "0x89", "0x8f", "0xcc", "0xb8"]}, + {"Name": "NotLeftTriangle", "Characters": ["0xe2", "0x8b", "0xaa"]}, + {"Name": "NotLeftTriangleBar", "Characters": ["0xe2", "0xa7", "0x8f", "0xcc", "0xb8"]}, + {"Name": "NotLeftTriangleEqual", "Characters": ["0xe2", "0x8b", "0xac"]}, + {"Name": "NotLess", "Characters": ["0xe2", "0x89", "0xae"]}, + {"Name": "NotLessEqual", "Characters": ["0xe2", "0x89", "0xb0"]}, + {"Name": "NotLessGreater", "Characters": ["0xe2", "0x89", "0xb8"]}, + {"Name": "NotLessLess", "Characters": ["0xe2", "0x89", "0xaa", "0xcc", "0xb8"]}, + {"Name": "NotLessSlantEqual", "Characters": ["0xe2", "0xa9", "0xbd", "0xcc", "0xb8"]}, + {"Name": "NotLessTilde", "Characters": ["0xe2", "0x89", "0xb4"]}, + {"Name": "NotNestedGreaterGreater", "Characters": ["0xe2", "0xaa", "0xa2", "0xcc", "0xb8"]}, + {"Name": "NotNestedLessLess", "Characters": ["0xe2", "0xaa", "0xa1", "0xcc", "0xb8"]}, + {"Name": "NotPrecedes", "Characters": ["0xe2", "0x8a", "0x80"]}, + {"Name": "NotPrecedesEqual", "Characters": ["0xe2", "0xaa", "0xaf", "0xcc", "0xb8"]}, + {"Name": "NotPrecedesSlantEqual", "Characters": ["0xe2", "0x8b", "0xa0"]}, + {"Name": "NotReverseElement", "Characters": ["0xe2", "0x88", "0x8c"]}, + {"Name": "NotRightTriangle", "Characters": ["0xe2", "0x8b", "0xab"]}, + {"Name": "NotRightTriangleBar", "Characters": ["0xe2", "0xa7", "0x90", "0xcc", "0xb8"]}, + {"Name": "NotRightTriangleEqual", "Characters": ["0xe2", "0x8b", "0xad"]}, + {"Name": "NotSquareSubset", "Characters": ["0xe2", "0x8a", "0x8f", "0xcc", "0xb8"]}, + {"Name": "NotSquareSubsetEqual", "Characters": ["0xe2", "0x8b", "0xa2"]}, + {"Name": "NotSquareSuperset", "Characters": ["0xe2", "0x8a", "0x90", "0xcc", "0xb8"]}, + {"Name": "NotSquareSupersetEqual", "Characters": ["0xe2", "0x8b", "0xa3"]}, + {"Name": "NotSubset", "Characters": ["0xe2", "0x8a", "0x82", "0xe2", "0x83", "0x92"]}, + {"Name": "NotSubsetEqual", "Characters": ["0xe2", "0x8a", "0x88"]}, + {"Name": "NotSucceeds", "Characters": ["0xe2", "0x8a", "0x81"]}, + {"Name": "NotSucceedsEqual", "Characters": ["0xe2", "0xaa", "0xb0", "0xcc", "0xb8"]}, + {"Name": "NotSucceedsSlantEqual", "Characters": ["0xe2", "0x8b", "0xa1"]}, + {"Name": "NotSucceedsTilde", "Characters": ["0xe2", "0x89", "0xbf", "0xcc", "0xb8"]}, + {"Name": "NotSuperset", "Characters": ["0xe2", "0x8a", "0x83", "0xe2", "0x83", "0x92"]}, + {"Name": "NotSupersetEqual", "Characters": ["0xe2", "0x8a", "0x89"]}, + {"Name": "NotTilde", "Characters": ["0xe2", "0x89", "0x81"]}, + {"Name": "NotTildeEqual", "Characters": ["0xe2", "0x89", "0x84"]}, + {"Name": "NotTildeFullEqual", "Characters": ["0xe2", "0x89", "0x87"]}, + {"Name": "NotTildeTilde", "Characters": ["0xe2", "0x89", "0x89"]}, + {"Name": "NotVerticalBar", "Characters": ["0xe2", "0x88", "0xa4"]}, + {"Name": "Nscr", "Characters": ["0xf0", "0x9d", "0x92", "0xa9"]}, + {"Name": "Ntilde", "Characters": ["0xc3", "0x91"]}, + {"Name": "Nu", "Characters": ["0xce", "0x9d"]}, + {"Name": "OElig", "Characters": ["0xc5", "0x92"]}, + {"Name": "Oacute", "Characters": ["0xc3", "0x93"]}, + {"Name": "Ocirc", "Characters": ["0xc3", "0x94"]}, + {"Name": "Ocy", "Characters": ["0xd0", "0x9e"]}, + {"Name": "Odblac", "Characters": ["0xc5", "0x90"]}, + {"Name": "Ofr", "Characters": ["0xf0", "0x9d", "0x94", "0x92"]}, + {"Name": "Ograve", "Characters": ["0xc3", "0x92"]}, + {"Name": "Omacr", "Characters": ["0xc5", "0x8c"]}, + {"Name": "Omega", "Characters": ["0xce", "0xa9"]}, + {"Name": "Omicron", "Characters": ["0xce", "0x9f"]}, + {"Name": "Oopf", "Characters": ["0xf0", "0x9d", "0x95", "0x86"]}, + {"Name": "OpenCurlyDoubleQuote", "Characters": ["0xe2", "0x80", "0x9c"]}, + {"Name": "OpenCurlyQuote", "Characters": ["0xe2", "0x80", "0x98"]}, + {"Name": "Or", "Characters": ["0xe2", "0xa9", "0x94"]}, + {"Name": "Oscr", "Characters": ["0xf0", "0x9d", "0x92", "0xaa"]}, + {"Name": "Oslash", "Characters": ["0xc3", "0x98"]}, + {"Name": "Otilde", "Characters": ["0xc3", "0x95"]}, + {"Name": "Otimes", "Characters": ["0xe2", "0xa8", "0xb7"]}, + {"Name": "Ouml", "Characters": ["0xc3", "0x96"]}, + {"Name": "OverBar", "Characters": ["0xe2", "0x80", "0xbe"]}, + {"Name": "OverBrace", "Characters": ["0xe2", "0x8f", "0x9e"]}, + {"Name": "OverBracket", "Characters": ["0xe2", "0x8e", "0xb4"]}, + {"Name": "OverParenthesis", "Characters": ["0xe2", "0x8f", "0x9c"]}, + {"Name": "PartialD", "Characters": ["0xe2", "0x88", "0x82"]}, + {"Name": "Pcy", "Characters": ["0xd0", "0x9f"]}, + {"Name": "Pfr", "Characters": ["0xf0", "0x9d", "0x94", "0x93"]}, + {"Name": "Phi", "Characters": ["0xce", "0xa6"]}, + {"Name": "Pi", "Characters": ["0xce", "0xa0"]}, + {"Name": "PlusMinus", "Characters": ["0xc2", "0xb1"]}, + {"Name": "Poincareplane", "Characters": ["0xe2", "0x84", "0x8c"]}, + {"Name": "Popf", "Characters": ["0xe2", "0x84", "0x99"]}, + {"Name": "Pr", "Characters": ["0xe2", "0xaa", "0xbb"]}, + {"Name": "Precedes", "Characters": ["0xe2", "0x89", "0xba"]}, + {"Name": "PrecedesEqual", "Characters": ["0xe2", "0xaa", "0xaf"]}, + {"Name": "PrecedesSlantEqual", "Characters": ["0xe2", "0x89", "0xbc"]}, + {"Name": "PrecedesTilde", "Characters": ["0xe2", "0x89", "0xbe"]}, + {"Name": "Prime", "Characters": ["0xe2", "0x80", "0xb3"]}, + {"Name": "Product", "Characters": ["0xe2", "0x88", "0x8f"]}, + {"Name": "Proportion", "Characters": ["0xe2", "0x88", "0xb7"]}, + {"Name": "Proportional", "Characters": ["0xe2", "0x88", "0x9d"]}, + {"Name": "Pscr", "Characters": ["0xf0", "0x9d", "0x92", "0xab"]}, + {"Name": "Psi", "Characters": ["0xce", "0xa8"]}, + {"Name": "QUOT", "Characters": ["0x22"]}, + {"Name": "Qfr", "Characters": ["0xf0", "0x9d", "0x94", "0x94"]}, + {"Name": "Qopf", "Characters": ["0xe2", "0x84", "0x9a"]}, + {"Name": "Qscr", "Characters": ["0xf0", "0x9d", "0x92", "0xac"]}, + {"Name": "RBarr", "Characters": ["0xe2", "0xa4", "0x90"]}, + {"Name": "REG", "Characters": ["0xc2", "0xae"]}, + {"Name": "Racute", "Characters": ["0xc5", "0x94"]}, + {"Name": "Rang", "Characters": ["0xe2", "0x9f", "0xab"]}, + {"Name": "Rarr", "Characters": ["0xe2", "0x86", "0xa0"]}, + {"Name": "Rarrtl", "Characters": ["0xe2", "0xa4", "0x96"]}, + {"Name": "Rcaron", "Characters": ["0xc5", "0x98"]}, + {"Name": "Rcedil", "Characters": ["0xc5", "0x96"]}, + {"Name": "Rcy", "Characters": ["0xd0", "0xa0"]}, + {"Name": "Re", "Characters": ["0xe2", "0x84", "0x9c"]}, + {"Name": "ReverseElement", "Characters": ["0xe2", "0x88", "0x8b"]}, + {"Name": "ReverseEquilibrium", "Characters": ["0xe2", "0x87", "0x8b"]}, + {"Name": "ReverseUpEquilibrium", "Characters": ["0xe2", "0xa5", "0xaf"]}, + {"Name": "Rfr", "Characters": ["0xe2", "0x84", "0x9c"]}, + {"Name": "Rho", "Characters": ["0xce", "0xa1"]}, + {"Name": "RightAngleBracket", "Characters": ["0xe2", "0x9f", "0xa9"]}, + {"Name": "RightArrow", "Characters": ["0xe2", "0x86", "0x92"]}, + {"Name": "RightArrowBar", "Characters": ["0xe2", "0x87", "0xa5"]}, + {"Name": "RightArrowLeftArrow", "Characters": ["0xe2", "0x87", "0x84"]}, + {"Name": "RightCeiling", "Characters": ["0xe2", "0x8c", "0x89"]}, + {"Name": "RightDoubleBracket", "Characters": ["0xe2", "0x9f", "0xa7"]}, + {"Name": "RightDownTeeVector", "Characters": ["0xe2", "0xa5", "0x9d"]}, + {"Name": "RightDownVector", "Characters": ["0xe2", "0x87", "0x82"]}, + {"Name": "RightDownVectorBar", "Characters": ["0xe2", "0xa5", "0x95"]}, + {"Name": "RightFloor", "Characters": ["0xe2", "0x8c", "0x8b"]}, + {"Name": "RightTee", "Characters": ["0xe2", "0x8a", "0xa2"]}, + {"Name": "RightTeeArrow", "Characters": ["0xe2", "0x86", "0xa6"]}, + {"Name": "RightTeeVector", "Characters": ["0xe2", "0xa5", "0x9b"]}, + {"Name": "RightTriangle", "Characters": ["0xe2", "0x8a", "0xb3"]}, + {"Name": "RightTriangleBar", "Characters": ["0xe2", "0xa7", "0x90"]}, + {"Name": "RightTriangleEqual", "Characters": ["0xe2", "0x8a", "0xb5"]}, + {"Name": "RightUpDownVector", "Characters": ["0xe2", "0xa5", "0x8f"]}, + {"Name": "RightUpTeeVector", "Characters": ["0xe2", "0xa5", "0x9c"]}, + {"Name": "RightUpVector", "Characters": ["0xe2", "0x86", "0xbe"]}, + {"Name": "RightUpVectorBar", "Characters": ["0xe2", "0xa5", "0x94"]}, + {"Name": "RightVector", "Characters": ["0xe2", "0x87", "0x80"]}, + {"Name": "RightVectorBar", "Characters": ["0xe2", "0xa5", "0x93"]}, + {"Name": "Rightarrow", "Characters": ["0xe2", "0x87", "0x92"]}, + {"Name": "Ropf", "Characters": ["0xe2", "0x84", "0x9d"]}, + {"Name": "RoundImplies", "Characters": ["0xe2", "0xa5", "0xb0"]}, + {"Name": "Rrightarrow", "Characters": ["0xe2", "0x87", "0x9b"]}, + {"Name": "Rscr", "Characters": ["0xe2", "0x84", "0x9b"]}, + {"Name": "Rsh", "Characters": ["0xe2", "0x86", "0xb1"]}, + {"Name": "RuleDelayed", "Characters": ["0xe2", "0xa7", "0xb4"]}, + {"Name": "SHCHcy", "Characters": ["0xd0", "0xa9"]}, + {"Name": "SHcy", "Characters": ["0xd0", "0xa8"]}, + {"Name": "SOFTcy", "Characters": ["0xd0", "0xac"]}, + {"Name": "Sacute", "Characters": ["0xc5", "0x9a"]}, + {"Name": "Sc", "Characters": ["0xe2", "0xaa", "0xbc"]}, + {"Name": "Scaron", "Characters": ["0xc5", "0xa0"]}, + {"Name": "Scedil", "Characters": ["0xc5", "0x9e"]}, + {"Name": "Scirc", "Characters": ["0xc5", "0x9c"]}, + {"Name": "Scy", "Characters": ["0xd0", "0xa1"]}, + {"Name": "Sfr", "Characters": ["0xf0", "0x9d", "0x94", "0x96"]}, + {"Name": "ShortDownArrow", "Characters": ["0xe2", "0x86", "0x93"]}, + {"Name": "ShortLeftArrow", "Characters": ["0xe2", "0x86", "0x90"]}, + {"Name": "ShortRightArrow", "Characters": ["0xe2", "0x86", "0x92"]}, + {"Name": "ShortUpArrow", "Characters": ["0xe2", "0x86", "0x91"]}, + {"Name": "Sigma", "Characters": ["0xce", "0xa3"]}, + {"Name": "SmallCircle", "Characters": ["0xe2", "0x88", "0x98"]}, + {"Name": "Sopf", "Characters": ["0xf0", "0x9d", "0x95", "0x8a"]}, + {"Name": "Sqrt", "Characters": ["0xe2", "0x88", "0x9a"]}, + {"Name": "Square", "Characters": ["0xe2", "0x96", "0xa1"]}, + {"Name": "SquareIntersection", "Characters": ["0xe2", "0x8a", "0x93"]}, + {"Name": "SquareSubset", "Characters": ["0xe2", "0x8a", "0x8f"]}, + {"Name": "SquareSubsetEqual", "Characters": ["0xe2", "0x8a", "0x91"]}, + {"Name": "SquareSuperset", "Characters": ["0xe2", "0x8a", "0x90"]}, + {"Name": "SquareSupersetEqual", "Characters": ["0xe2", "0x8a", "0x92"]}, + {"Name": "SquareUnion", "Characters": ["0xe2", "0x8a", "0x94"]}, + {"Name": "Sscr", "Characters": ["0xf0", "0x9d", "0x92", "0xae"]}, + {"Name": "Star", "Characters": ["0xe2", "0x8b", "0x86"]}, + {"Name": "Sub", "Characters": ["0xe2", "0x8b", "0x90"]}, + {"Name": "Subset", "Characters": ["0xe2", "0x8b", "0x90"]}, + {"Name": "SubsetEqual", "Characters": ["0xe2", "0x8a", "0x86"]}, + {"Name": "Succeeds", "Characters": ["0xe2", "0x89", "0xbb"]}, + {"Name": "SucceedsEqual", "Characters": ["0xe2", "0xaa", "0xb0"]}, + {"Name": "SucceedsSlantEqual", "Characters": ["0xe2", "0x89", "0xbd"]}, + {"Name": "SucceedsTilde", "Characters": ["0xe2", "0x89", "0xbf"]}, + {"Name": "SuchThat", "Characters": ["0xe2", "0x88", "0x8b"]}, + {"Name": "Sum", "Characters": ["0xe2", "0x88", "0x91"]}, + {"Name": "Sup", "Characters": ["0xe2", "0x8b", "0x91"]}, + {"Name": "Superset", "Characters": ["0xe2", "0x8a", "0x83"]}, + {"Name": "SupersetEqual", "Characters": ["0xe2", "0x8a", "0x87"]}, + {"Name": "Supset", "Characters": ["0xe2", "0x8b", "0x91"]}, + {"Name": "THORN", "Characters": ["0xc3", "0x9e"]}, + {"Name": "TRADE", "Characters": ["0xe2", "0x84", "0xa2"]}, + {"Name": "TSHcy", "Characters": ["0xd0", "0x8b"]}, + {"Name": "TScy", "Characters": ["0xd0", "0xa6"]}, + {"Name": "Tab", "Characters": ["0x9"]}, + {"Name": "Tau", "Characters": ["0xce", "0xa4"]}, + {"Name": "Tcaron", "Characters": ["0xc5", "0xa4"]}, + {"Name": "Tcedil", "Characters": ["0xc5", "0xa2"]}, + {"Name": "Tcy", "Characters": ["0xd0", "0xa2"]}, + {"Name": "Tfr", "Characters": ["0xf0", "0x9d", "0x94", "0x97"]}, + {"Name": "Therefore", "Characters": ["0xe2", "0x88", "0xb4"]}, + {"Name": "Theta", "Characters": ["0xce", "0x98"]}, + {"Name": "ThickSpace", "Characters": ["0xe2", "0x81", "0x9f", "0xe2", "0x80", "0x8a"]}, + {"Name": "ThinSpace", "Characters": ["0xe2", "0x80", "0x89"]}, + {"Name": "Tilde", "Characters": ["0xe2", "0x88", "0xbc"]}, + {"Name": "TildeEqual", "Characters": ["0xe2", "0x89", "0x83"]}, + {"Name": "TildeFullEqual", "Characters": ["0xe2", "0x89", "0x85"]}, + {"Name": "TildeTilde", "Characters": ["0xe2", "0x89", "0x88"]}, + {"Name": "Topf", "Characters": ["0xf0", "0x9d", "0x95", "0x8b"]}, + {"Name": "TripleDot", "Characters": ["0xe2", "0x83", "0x9b"]}, + {"Name": "Tscr", "Characters": ["0xf0", "0x9d", "0x92", "0xaf"]}, + {"Name": "Tstrok", "Characters": ["0xc5", "0xa6"]}, + {"Name": "Uacute", "Characters": ["0xc3", "0x9a"]}, + {"Name": "Uarr", "Characters": ["0xe2", "0x86", "0x9f"]}, + {"Name": "Uarrocir", "Characters": ["0xe2", "0xa5", "0x89"]}, + {"Name": "Ubrcy", "Characters": ["0xd0", "0x8e"]}, + {"Name": "Ubreve", "Characters": ["0xc5", "0xac"]}, + {"Name": "Ucirc", "Characters": ["0xc3", "0x9b"]}, + {"Name": "Ucy", "Characters": ["0xd0", "0xa3"]}, + {"Name": "Udblac", "Characters": ["0xc5", "0xb0"]}, + {"Name": "Ufr", "Characters": ["0xf0", "0x9d", "0x94", "0x98"]}, + {"Name": "Ugrave", "Characters": ["0xc3", "0x99"]}, + {"Name": "Umacr", "Characters": ["0xc5", "0xaa"]}, + {"Name": "UnderBar", "Characters": ["0x5f"]}, + {"Name": "UnderBrace", "Characters": ["0xe2", "0x8f", "0x9f"]}, + {"Name": "UnderBracket", "Characters": ["0xe2", "0x8e", "0xb5"]}, + {"Name": "UnderParenthesis", "Characters": ["0xe2", "0x8f", "0x9d"]}, + {"Name": "Union", "Characters": ["0xe2", "0x8b", "0x83"]}, + {"Name": "UnionPlus", "Characters": ["0xe2", "0x8a", "0x8e"]}, + {"Name": "Uogon", "Characters": ["0xc5", "0xb2"]}, + {"Name": "Uopf", "Characters": ["0xf0", "0x9d", "0x95", "0x8c"]}, + {"Name": "UpArrow", "Characters": ["0xe2", "0x86", "0x91"]}, + {"Name": "UpArrowBar", "Characters": ["0xe2", "0xa4", "0x92"]}, + {"Name": "UpArrowDownArrow", "Characters": ["0xe2", "0x87", "0x85"]}, + {"Name": "UpDownArrow", "Characters": ["0xe2", "0x86", "0x95"]}, + {"Name": "UpEquilibrium", "Characters": ["0xe2", "0xa5", "0xae"]}, + {"Name": "UpTee", "Characters": ["0xe2", "0x8a", "0xa5"]}, + {"Name": "UpTeeArrow", "Characters": ["0xe2", "0x86", "0xa5"]}, + {"Name": "Uparrow", "Characters": ["0xe2", "0x87", "0x91"]}, + {"Name": "Updownarrow", "Characters": ["0xe2", "0x87", "0x95"]}, + {"Name": "UpperLeftArrow", "Characters": ["0xe2", "0x86", "0x96"]}, + {"Name": "UpperRightArrow", "Characters": ["0xe2", "0x86", "0x97"]}, + {"Name": "Upsi", "Characters": ["0xcf", "0x92"]}, + {"Name": "Upsilon", "Characters": ["0xce", "0xa5"]}, + {"Name": "Uring", "Characters": ["0xc5", "0xae"]}, + {"Name": "Uscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb0"]}, + {"Name": "Utilde", "Characters": ["0xc5", "0xa8"]}, + {"Name": "Uuml", "Characters": ["0xc3", "0x9c"]}, + {"Name": "VDash", "Characters": ["0xe2", "0x8a", "0xab"]}, + {"Name": "Vbar", "Characters": ["0xe2", "0xab", "0xab"]}, + {"Name": "Vcy", "Characters": ["0xd0", "0x92"]}, + {"Name": "Vdash", "Characters": ["0xe2", "0x8a", "0xa9"]}, + {"Name": "Vdashl", "Characters": ["0xe2", "0xab", "0xa6"]}, + {"Name": "Vee", "Characters": ["0xe2", "0x8b", "0x81"]}, + {"Name": "Verbar", "Characters": ["0xe2", "0x80", "0x96"]}, + {"Name": "Vert", "Characters": ["0xe2", "0x80", "0x96"]}, + {"Name": "VerticalBar", "Characters": ["0xe2", "0x88", "0xa3"]}, + {"Name": "VerticalLine", "Characters": ["0x7c"]}, + {"Name": "VerticalSeparator", "Characters": ["0xe2", "0x9d", "0x98"]}, + {"Name": "VerticalTilde", "Characters": ["0xe2", "0x89", "0x80"]}, + {"Name": "VeryThinSpace", "Characters": ["0xe2", "0x80", "0x8a"]}, + {"Name": "Vfr", "Characters": ["0xf0", "0x9d", "0x94", "0x99"]}, + {"Name": "Vopf", "Characters": ["0xf0", "0x9d", "0x95", "0x8d"]}, + {"Name": "Vscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb1"]}, + {"Name": "Vvdash", "Characters": ["0xe2", "0x8a", "0xaa"]}, + {"Name": "Wcirc", "Characters": ["0xc5", "0xb4"]}, + {"Name": "Wedge", "Characters": ["0xe2", "0x8b", "0x80"]}, + {"Name": "Wfr", "Characters": ["0xf0", "0x9d", "0x94", "0x9a"]}, + {"Name": "Wopf", "Characters": ["0xf0", "0x9d", "0x95", "0x8e"]}, + {"Name": "Wscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb2"]}, + {"Name": "Xfr", "Characters": ["0xf0", "0x9d", "0x94", "0x9b"]}, + {"Name": "Xi", "Characters": ["0xce", "0x9e"]}, + {"Name": "Xopf", "Characters": ["0xf0", "0x9d", "0x95", "0x8f"]}, + {"Name": "Xscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb3"]}, + {"Name": "YAcy", "Characters": ["0xd0", "0xaf"]}, + {"Name": "YIcy", "Characters": ["0xd0", "0x87"]}, + {"Name": "YUcy", "Characters": ["0xd0", "0xae"]}, + {"Name": "Yacute", "Characters": ["0xc3", "0x9d"]}, + {"Name": "Ycirc", "Characters": ["0xc5", "0xb6"]}, + {"Name": "Ycy", "Characters": ["0xd0", "0xab"]}, + {"Name": "Yfr", "Characters": ["0xf0", "0x9d", "0x94", "0x9c"]}, + {"Name": "Yopf", "Characters": ["0xf0", "0x9d", "0x95", "0x90"]}, + {"Name": "Yscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb4"]}, + {"Name": "Yuml", "Characters": ["0xc5", "0xb8"]}, + {"Name": "ZHcy", "Characters": ["0xd0", "0x96"]}, + {"Name": "Zacute", "Characters": ["0xc5", "0xb9"]}, + {"Name": "Zcaron", "Characters": ["0xc5", "0xbd"]}, + {"Name": "Zcy", "Characters": ["0xd0", "0x97"]}, + {"Name": "Zdot", "Characters": ["0xc5", "0xbb"]}, + {"Name": "ZeroWidthSpace", "Characters": ["0xe2", "0x80", "0x8b"]}, + {"Name": "Zeta", "Characters": ["0xce", "0x96"]}, + {"Name": "Zfr", "Characters": ["0xe2", "0x84", "0xa8"]}, + {"Name": "Zopf", "Characters": ["0xe2", "0x84", "0xa4"]}, + {"Name": "Zscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb5"]}, + {"Name": "aacute", "Characters": ["0xc3", "0xa1"]}, + {"Name": "abreve", "Characters": ["0xc4", "0x83"]}, + {"Name": "ac", "Characters": ["0xe2", "0x88", "0xbe"]}, + {"Name": "acE", "Characters": ["0xe2", "0x88", "0xbe", "0xcc", "0xb3"]}, + {"Name": "acd", "Characters": ["0xe2", "0x88", "0xbf"]}, + {"Name": "acirc", "Characters": ["0xc3", "0xa2"]}, + {"Name": "acute", "Characters": ["0xc2", "0xb4"]}, + {"Name": "acy", "Characters": ["0xd0", "0xb0"]}, + {"Name": "aelig", "Characters": ["0xc3", "0xa6"]}, + {"Name": "af", "Characters": ["0xe2", "0x81", "0xa1"]}, + {"Name": "afr", "Characters": ["0xf0", "0x9d", "0x94", "0x9e"]}, + {"Name": "agrave", "Characters": ["0xc3", "0xa0"]}, + {"Name": "alefsym", "Characters": ["0xe2", "0x84", "0xb5"]}, + {"Name": "aleph", "Characters": ["0xe2", "0x84", "0xb5"]}, + {"Name": "alpha", "Characters": ["0xce", "0xb1"]}, + {"Name": "amacr", "Characters": ["0xc4", "0x81"]}, + {"Name": "amalg", "Characters": ["0xe2", "0xa8", "0xbf"]}, + {"Name": "amp", "Characters": ["0x26"]}, + {"Name": "and", "Characters": ["0xe2", "0x88", "0xa7"]}, + {"Name": "andand", "Characters": ["0xe2", "0xa9", "0x95"]}, + {"Name": "andd", "Characters": ["0xe2", "0xa9", "0x9c"]}, + {"Name": "andslope", "Characters": ["0xe2", "0xa9", "0x98"]}, + {"Name": "andv", "Characters": ["0xe2", "0xa9", "0x9a"]}, + {"Name": "ang", "Characters": ["0xe2", "0x88", "0xa0"]}, + {"Name": "ange", "Characters": ["0xe2", "0xa6", "0xa4"]}, + {"Name": "angle", "Characters": ["0xe2", "0x88", "0xa0"]}, + {"Name": "angmsd", "Characters": ["0xe2", "0x88", "0xa1"]}, + {"Name": "angmsdaa", "Characters": ["0xe2", "0xa6", "0xa8"]}, + {"Name": "angmsdab", "Characters": ["0xe2", "0xa6", "0xa9"]}, + {"Name": "angmsdac", "Characters": ["0xe2", "0xa6", "0xaa"]}, + {"Name": "angmsdad", "Characters": ["0xe2", "0xa6", "0xab"]}, + {"Name": "angmsdae", "Characters": ["0xe2", "0xa6", "0xac"]}, + {"Name": "angmsdaf", "Characters": ["0xe2", "0xa6", "0xad"]}, + {"Name": "angmsdag", "Characters": ["0xe2", "0xa6", "0xae"]}, + {"Name": "angmsdah", "Characters": ["0xe2", "0xa6", "0xaf"]}, + {"Name": "angrt", "Characters": ["0xe2", "0x88", "0x9f"]}, + {"Name": "angrtvb", "Characters": ["0xe2", "0x8a", "0xbe"]}, + {"Name": "angrtvbd", "Characters": ["0xe2", "0xa6", "0x9d"]}, + {"Name": "angsph", "Characters": ["0xe2", "0x88", "0xa2"]}, + {"Name": "angst", "Characters": ["0xc3", "0x85"]}, + {"Name": "angzarr", "Characters": ["0xe2", "0x8d", "0xbc"]}, + {"Name": "aogon", "Characters": ["0xc4", "0x85"]}, + {"Name": "aopf", "Characters": ["0xf0", "0x9d", "0x95", "0x92"]}, + {"Name": "ap", "Characters": ["0xe2", "0x89", "0x88"]}, + {"Name": "apE", "Characters": ["0xe2", "0xa9", "0xb0"]}, + {"Name": "apacir", "Characters": ["0xe2", "0xa9", "0xaf"]}, + {"Name": "ape", "Characters": ["0xe2", "0x89", "0x8a"]}, + {"Name": "apid", "Characters": ["0xe2", "0x89", "0x8b"]}, + {"Name": "apos", "Characters": ["0x27"]}, + {"Name": "approx", "Characters": ["0xe2", "0x89", "0x88"]}, + {"Name": "approxeq", "Characters": ["0xe2", "0x89", "0x8a"]}, + {"Name": "aring", "Characters": ["0xc3", "0xa5"]}, + {"Name": "ascr", "Characters": ["0xf0", "0x9d", "0x92", "0xb6"]}, + {"Name": "ast", "Characters": ["0x2a"]}, + {"Name": "asymp", "Characters": ["0xe2", "0x89", "0x88"]}, + {"Name": "asympeq", "Characters": ["0xe2", "0x89", "0x8d"]}, + {"Name": "atilde", "Characters": ["0xc3", "0xa3"]}, + {"Name": "auml", "Characters": ["0xc3", "0xa4"]}, + {"Name": "awconint", "Characters": ["0xe2", "0x88", "0xb3"]}, + {"Name": "awint", "Characters": ["0xe2", "0xa8", "0x91"]}, + {"Name": "bNot", "Characters": ["0xe2", "0xab", "0xad"]}, + {"Name": "backcong", "Characters": ["0xe2", "0x89", "0x8c"]}, + {"Name": "backepsilon", "Characters": ["0xcf", "0xb6"]}, + {"Name": "backprime", "Characters": ["0xe2", "0x80", "0xb5"]}, + {"Name": "backsim", "Characters": ["0xe2", "0x88", "0xbd"]}, + {"Name": "backsimeq", "Characters": ["0xe2", "0x8b", "0x8d"]}, + {"Name": "barvee", "Characters": ["0xe2", "0x8a", "0xbd"]}, + {"Name": "barwed", "Characters": ["0xe2", "0x8c", "0x85"]}, + {"Name": "barwedge", "Characters": ["0xe2", "0x8c", "0x85"]}, + {"Name": "bbrk", "Characters": ["0xe2", "0x8e", "0xb5"]}, + {"Name": "bbrktbrk", "Characters": ["0xe2", "0x8e", "0xb6"]}, + {"Name": "bcong", "Characters": ["0xe2", "0x89", "0x8c"]}, + {"Name": "bcy", "Characters": ["0xd0", "0xb1"]}, + {"Name": "bdquo", "Characters": ["0xe2", "0x80", "0x9e"]}, + {"Name": "becaus", "Characters": ["0xe2", "0x88", "0xb5"]}, + {"Name": "because", "Characters": ["0xe2", "0x88", "0xb5"]}, + {"Name": "bemptyv", "Characters": ["0xe2", "0xa6", "0xb0"]}, + {"Name": "bepsi", "Characters": ["0xcf", "0xb6"]}, + {"Name": "bernou", "Characters": ["0xe2", "0x84", "0xac"]}, + {"Name": "beta", "Characters": ["0xce", "0xb2"]}, + {"Name": "beth", "Characters": ["0xe2", "0x84", "0xb6"]}, + {"Name": "between", "Characters": ["0xe2", "0x89", "0xac"]}, + {"Name": "bfr", "Characters": ["0xf0", "0x9d", "0x94", "0x9f"]}, + {"Name": "bigcap", "Characters": ["0xe2", "0x8b", "0x82"]}, + {"Name": "bigcirc", "Characters": ["0xe2", "0x97", "0xaf"]}, + {"Name": "bigcup", "Characters": ["0xe2", "0x8b", "0x83"]}, + {"Name": "bigodot", "Characters": ["0xe2", "0xa8", "0x80"]}, + {"Name": "bigoplus", "Characters": ["0xe2", "0xa8", "0x81"]}, + {"Name": "bigotimes", "Characters": ["0xe2", "0xa8", "0x82"]}, + {"Name": "bigsqcup", "Characters": ["0xe2", "0xa8", "0x86"]}, + {"Name": "bigstar", "Characters": ["0xe2", "0x98", "0x85"]}, + {"Name": "bigtriangledown", "Characters": ["0xe2", "0x96", "0xbd"]}, + {"Name": "bigtriangleup", "Characters": ["0xe2", "0x96", "0xb3"]}, + {"Name": "biguplus", "Characters": ["0xe2", "0xa8", "0x84"]}, + {"Name": "bigvee", "Characters": ["0xe2", "0x8b", "0x81"]}, + {"Name": "bigwedge", "Characters": ["0xe2", "0x8b", "0x80"]}, + {"Name": "bkarow", "Characters": ["0xe2", "0xa4", "0x8d"]}, + {"Name": "blacklozenge", "Characters": ["0xe2", "0xa7", "0xab"]}, + {"Name": "blacksquare", "Characters": ["0xe2", "0x96", "0xaa"]}, + {"Name": "blacktriangle", "Characters": ["0xe2", "0x96", "0xb4"]}, + {"Name": "blacktriangledown", "Characters": ["0xe2", "0x96", "0xbe"]}, + {"Name": "blacktriangleleft", "Characters": ["0xe2", "0x97", "0x82"]}, + {"Name": "blacktriangleright", "Characters": ["0xe2", "0x96", "0xb8"]}, + {"Name": "blank", "Characters": ["0xe2", "0x90", "0xa3"]}, + {"Name": "blk12", "Characters": ["0xe2", "0x96", "0x92"]}, + {"Name": "blk14", "Characters": ["0xe2", "0x96", "0x91"]}, + {"Name": "blk34", "Characters": ["0xe2", "0x96", "0x93"]}, + {"Name": "block", "Characters": ["0xe2", "0x96", "0x88"]}, + {"Name": "bne", "Characters": ["0x3d", "0xe2", "0x83", "0xa5"]}, + {"Name": "bnequiv", "Characters": ["0xe2", "0x89", "0xa1", "0xe2", "0x83", "0xa5"]}, + {"Name": "bnot", "Characters": ["0xe2", "0x8c", "0x90"]}, + {"Name": "bopf", "Characters": ["0xf0", "0x9d", "0x95", "0x93"]}, + {"Name": "bot", "Characters": ["0xe2", "0x8a", "0xa5"]}, + {"Name": "bottom", "Characters": ["0xe2", "0x8a", "0xa5"]}, + {"Name": "bowtie", "Characters": ["0xe2", "0x8b", "0x88"]}, + {"Name": "boxDL", "Characters": ["0xe2", "0x95", "0x97"]}, + {"Name": "boxDR", "Characters": ["0xe2", "0x95", "0x94"]}, + {"Name": "boxDl", "Characters": ["0xe2", "0x95", "0x96"]}, + {"Name": "boxDr", "Characters": ["0xe2", "0x95", "0x93"]}, + {"Name": "boxH", "Characters": ["0xe2", "0x95", "0x90"]}, + {"Name": "boxHD", "Characters": ["0xe2", "0x95", "0xa6"]}, + {"Name": "boxHU", "Characters": ["0xe2", "0x95", "0xa9"]}, + {"Name": "boxHd", "Characters": ["0xe2", "0x95", "0xa4"]}, + {"Name": "boxHu", "Characters": ["0xe2", "0x95", "0xa7"]}, + {"Name": "boxUL", "Characters": ["0xe2", "0x95", "0x9d"]}, + {"Name": "boxUR", "Characters": ["0xe2", "0x95", "0x9a"]}, + {"Name": "boxUl", "Characters": ["0xe2", "0x95", "0x9c"]}, + {"Name": "boxUr", "Characters": ["0xe2", "0x95", "0x99"]}, + {"Name": "boxV", "Characters": ["0xe2", "0x95", "0x91"]}, + {"Name": "boxVH", "Characters": ["0xe2", "0x95", "0xac"]}, + {"Name": "boxVL", "Characters": ["0xe2", "0x95", "0xa3"]}, + {"Name": "boxVR", "Characters": ["0xe2", "0x95", "0xa0"]}, + {"Name": "boxVh", "Characters": ["0xe2", "0x95", "0xab"]}, + {"Name": "boxVl", "Characters": ["0xe2", "0x95", "0xa2"]}, + {"Name": "boxVr", "Characters": ["0xe2", "0x95", "0x9f"]}, + {"Name": "boxbox", "Characters": ["0xe2", "0xa7", "0x89"]}, + {"Name": "boxdL", "Characters": ["0xe2", "0x95", "0x95"]}, + {"Name": "boxdR", "Characters": ["0xe2", "0x95", "0x92"]}, + {"Name": "boxdl", "Characters": ["0xe2", "0x94", "0x90"]}, + {"Name": "boxdr", "Characters": ["0xe2", "0x94", "0x8c"]}, + {"Name": "boxh", "Characters": ["0xe2", "0x94", "0x80"]}, + {"Name": "boxhD", "Characters": ["0xe2", "0x95", "0xa5"]}, + {"Name": "boxhU", "Characters": ["0xe2", "0x95", "0xa8"]}, + {"Name": "boxhd", "Characters": ["0xe2", "0x94", "0xac"]}, + {"Name": "boxhu", "Characters": ["0xe2", "0x94", "0xb4"]}, + {"Name": "boxminus", "Characters": ["0xe2", "0x8a", "0x9f"]}, + {"Name": "boxplus", "Characters": ["0xe2", "0x8a", "0x9e"]}, + {"Name": "boxtimes", "Characters": ["0xe2", "0x8a", "0xa0"]}, + {"Name": "boxuL", "Characters": ["0xe2", "0x95", "0x9b"]}, + {"Name": "boxuR", "Characters": ["0xe2", "0x95", "0x98"]}, + {"Name": "boxul", "Characters": ["0xe2", "0x94", "0x98"]}, + {"Name": "boxur", "Characters": ["0xe2", "0x94", "0x94"]}, + {"Name": "boxv", "Characters": ["0xe2", "0x94", "0x82"]}, + {"Name": "boxvH", "Characters": ["0xe2", "0x95", "0xaa"]}, + {"Name": "boxvL", "Characters": ["0xe2", "0x95", "0xa1"]}, + {"Name": "boxvR", "Characters": ["0xe2", "0x95", "0x9e"]}, + {"Name": "boxvh", "Characters": ["0xe2", "0x94", "0xbc"]}, + {"Name": "boxvl", "Characters": ["0xe2", "0x94", "0xa4"]}, + {"Name": "boxvr", "Characters": ["0xe2", "0x94", "0x9c"]}, + {"Name": "bprime", "Characters": ["0xe2", "0x80", "0xb5"]}, + {"Name": "breve", "Characters": ["0xcb", "0x98"]}, + {"Name": "brvbar", "Characters": ["0xc2", "0xa6"]}, + {"Name": "bscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb7"]}, + {"Name": "bsemi", "Characters": ["0xe2", "0x81", "0x8f"]}, + {"Name": "bsim", "Characters": ["0xe2", "0x88", "0xbd"]}, + {"Name": "bsime", "Characters": ["0xe2", "0x8b", "0x8d"]}, + {"Name": "bsol", "Characters": ["0x5c"]}, + {"Name": "bsolb", "Characters": ["0xe2", "0xa7", "0x85"]}, + {"Name": "bsolhsub", "Characters": ["0xe2", "0x9f", "0x88"]}, + {"Name": "bull", "Characters": ["0xe2", "0x80", "0xa2"]}, + {"Name": "bullet", "Characters": ["0xe2", "0x80", "0xa2"]}, + {"Name": "bump", "Characters": ["0xe2", "0x89", "0x8e"]}, + {"Name": "bumpE", "Characters": ["0xe2", "0xaa", "0xae"]}, + {"Name": "bumpe", "Characters": ["0xe2", "0x89", "0x8f"]}, + {"Name": "bumpeq", "Characters": ["0xe2", "0x89", "0x8f"]}, + {"Name": "cacute", "Characters": ["0xc4", "0x87"]}, + {"Name": "cap", "Characters": ["0xe2", "0x88", "0xa9"]}, + {"Name": "capand", "Characters": ["0xe2", "0xa9", "0x84"]}, + {"Name": "capbrcup", "Characters": ["0xe2", "0xa9", "0x89"]}, + {"Name": "capcap", "Characters": ["0xe2", "0xa9", "0x8b"]}, + {"Name": "capcup", "Characters": ["0xe2", "0xa9", "0x87"]}, + {"Name": "capdot", "Characters": ["0xe2", "0xa9", "0x80"]}, + {"Name": "caps", "Characters": ["0xe2", "0x88", "0xa9", "0xef", "0xb8", "0x80"]}, + {"Name": "caret", "Characters": ["0xe2", "0x81", "0x81"]}, + {"Name": "caron", "Characters": ["0xcb", "0x87"]}, + {"Name": "ccaps", "Characters": ["0xe2", "0xa9", "0x8d"]}, + {"Name": "ccaron", "Characters": ["0xc4", "0x8d"]}, + {"Name": "ccedil", "Characters": ["0xc3", "0xa7"]}, + {"Name": "ccirc", "Characters": ["0xc4", "0x89"]}, + {"Name": "ccups", "Characters": ["0xe2", "0xa9", "0x8c"]}, + {"Name": "ccupssm", "Characters": ["0xe2", "0xa9", "0x90"]}, + {"Name": "cdot", "Characters": ["0xc4", "0x8b"]}, + {"Name": "cedil", "Characters": ["0xc2", "0xb8"]}, + {"Name": "cemptyv", "Characters": ["0xe2", "0xa6", "0xb2"]}, + {"Name": "cent", "Characters": ["0xc2", "0xa2"]}, + {"Name": "centerdot", "Characters": ["0xc2", "0xb7"]}, + {"Name": "cfr", "Characters": ["0xf0", "0x9d", "0x94", "0xa0"]}, + {"Name": "chcy", "Characters": ["0xd1", "0x87"]}, + {"Name": "check", "Characters": ["0xe2", "0x9c", "0x93"]}, + {"Name": "checkmark", "Characters": ["0xe2", "0x9c", "0x93"]}, + {"Name": "chi", "Characters": ["0xcf", "0x87"]}, + {"Name": "cir", "Characters": ["0xe2", "0x97", "0x8b"]}, + {"Name": "cirE", "Characters": ["0xe2", "0xa7", "0x83"]}, + {"Name": "circ", "Characters": ["0xcb", "0x86"]}, + {"Name": "circeq", "Characters": ["0xe2", "0x89", "0x97"]}, + {"Name": "circlearrowleft", "Characters": ["0xe2", "0x86", "0xba"]}, + {"Name": "circlearrowright", "Characters": ["0xe2", "0x86", "0xbb"]}, + {"Name": "circledR", "Characters": ["0xc2", "0xae"]}, + {"Name": "circledS", "Characters": ["0xe2", "0x93", "0x88"]}, + {"Name": "circledast", "Characters": ["0xe2", "0x8a", "0x9b"]}, + {"Name": "circledcirc", "Characters": ["0xe2", "0x8a", "0x9a"]}, + {"Name": "circleddash", "Characters": ["0xe2", "0x8a", "0x9d"]}, + {"Name": "cire", "Characters": ["0xe2", "0x89", "0x97"]}, + {"Name": "cirfnint", "Characters": ["0xe2", "0xa8", "0x90"]}, + {"Name": "cirmid", "Characters": ["0xe2", "0xab", "0xaf"]}, + {"Name": "cirscir", "Characters": ["0xe2", "0xa7", "0x82"]}, + {"Name": "clubs", "Characters": ["0xe2", "0x99", "0xa3"]}, + {"Name": "clubsuit", "Characters": ["0xe2", "0x99", "0xa3"]}, + {"Name": "colon", "Characters": ["0x3a"]}, + {"Name": "colone", "Characters": ["0xe2", "0x89", "0x94"]}, + {"Name": "coloneq", "Characters": ["0xe2", "0x89", "0x94"]}, + {"Name": "comma", "Characters": ["0x2c"]}, + {"Name": "commat", "Characters": ["0x40"]}, + {"Name": "comp", "Characters": ["0xe2", "0x88", "0x81"]}, + {"Name": "compfn", "Characters": ["0xe2", "0x88", "0x98"]}, + {"Name": "complement", "Characters": ["0xe2", "0x88", "0x81"]}, + {"Name": "complexes", "Characters": ["0xe2", "0x84", "0x82"]}, + {"Name": "cong", "Characters": ["0xe2", "0x89", "0x85"]}, + {"Name": "congdot", "Characters": ["0xe2", "0xa9", "0xad"]}, + {"Name": "conint", "Characters": ["0xe2", "0x88", "0xae"]}, + {"Name": "copf", "Characters": ["0xf0", "0x9d", "0x95", "0x94"]}, + {"Name": "coprod", "Characters": ["0xe2", "0x88", "0x90"]}, + {"Name": "copy", "Characters": ["0xc2", "0xa9"]}, + {"Name": "copysr", "Characters": ["0xe2", "0x84", "0x97"]}, + {"Name": "crarr", "Characters": ["0xe2", "0x86", "0xb5"]}, + {"Name": "cross", "Characters": ["0xe2", "0x9c", "0x97"]}, + {"Name": "cscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb8"]}, + {"Name": "csub", "Characters": ["0xe2", "0xab", "0x8f"]}, + {"Name": "csube", "Characters": ["0xe2", "0xab", "0x91"]}, + {"Name": "csup", "Characters": ["0xe2", "0xab", "0x90"]}, + {"Name": "csupe", "Characters": ["0xe2", "0xab", "0x92"]}, + {"Name": "ctdot", "Characters": ["0xe2", "0x8b", "0xaf"]}, + {"Name": "cudarrl", "Characters": ["0xe2", "0xa4", "0xb8"]}, + {"Name": "cudarrr", "Characters": ["0xe2", "0xa4", "0xb5"]}, + {"Name": "cuepr", "Characters": ["0xe2", "0x8b", "0x9e"]}, + {"Name": "cuesc", "Characters": ["0xe2", "0x8b", "0x9f"]}, + {"Name": "cularr", "Characters": ["0xe2", "0x86", "0xb6"]}, + {"Name": "cularrp", "Characters": ["0xe2", "0xa4", "0xbd"]}, + {"Name": "cup", "Characters": ["0xe2", "0x88", "0xaa"]}, + {"Name": "cupbrcap", "Characters": ["0xe2", "0xa9", "0x88"]}, + {"Name": "cupcap", "Characters": ["0xe2", "0xa9", "0x86"]}, + {"Name": "cupcup", "Characters": ["0xe2", "0xa9", "0x8a"]}, + {"Name": "cupdot", "Characters": ["0xe2", "0x8a", "0x8d"]}, + {"Name": "cupor", "Characters": ["0xe2", "0xa9", "0x85"]}, + {"Name": "cups", "Characters": ["0xe2", "0x88", "0xaa", "0xef", "0xb8", "0x80"]}, + {"Name": "curarr", "Characters": ["0xe2", "0x86", "0xb7"]}, + {"Name": "curarrm", "Characters": ["0xe2", "0xa4", "0xbc"]}, + {"Name": "curlyeqprec", "Characters": ["0xe2", "0x8b", "0x9e"]}, + {"Name": "curlyeqsucc", "Characters": ["0xe2", "0x8b", "0x9f"]}, + {"Name": "curlyvee", "Characters": ["0xe2", "0x8b", "0x8e"]}, + {"Name": "curlywedge", "Characters": ["0xe2", "0x8b", "0x8f"]}, + {"Name": "curren", "Characters": ["0xc2", "0xa4"]}, + {"Name": "curvearrowleft", "Characters": ["0xe2", "0x86", "0xb6"]}, + {"Name": "curvearrowright", "Characters": ["0xe2", "0x86", "0xb7"]}, + {"Name": "cuvee", "Characters": ["0xe2", "0x8b", "0x8e"]}, + {"Name": "cuwed", "Characters": ["0xe2", "0x8b", "0x8f"]}, + {"Name": "cwconint", "Characters": ["0xe2", "0x88", "0xb2"]}, + {"Name": "cwint", "Characters": ["0xe2", "0x88", "0xb1"]}, + {"Name": "cylcty", "Characters": ["0xe2", "0x8c", "0xad"]}, + {"Name": "dArr", "Characters": ["0xe2", "0x87", "0x93"]}, + {"Name": "dHar", "Characters": ["0xe2", "0xa5", "0xa5"]}, + {"Name": "dagger", "Characters": ["0xe2", "0x80", "0xa0"]}, + {"Name": "daleth", "Characters": ["0xe2", "0x84", "0xb8"]}, + {"Name": "darr", "Characters": ["0xe2", "0x86", "0x93"]}, + {"Name": "dash", "Characters": ["0xe2", "0x80", "0x90"]}, + {"Name": "dashv", "Characters": ["0xe2", "0x8a", "0xa3"]}, + {"Name": "dbkarow", "Characters": ["0xe2", "0xa4", "0x8f"]}, + {"Name": "dblac", "Characters": ["0xcb", "0x9d"]}, + {"Name": "dcaron", "Characters": ["0xc4", "0x8f"]}, + {"Name": "dcy", "Characters": ["0xd0", "0xb4"]}, + {"Name": "dd", "Characters": ["0xe2", "0x85", "0x86"]}, + {"Name": "ddagger", "Characters": ["0xe2", "0x80", "0xa1"]}, + {"Name": "ddarr", "Characters": ["0xe2", "0x87", "0x8a"]}, + {"Name": "ddotseq", "Characters": ["0xe2", "0xa9", "0xb7"]}, + {"Name": "deg", "Characters": ["0xc2", "0xb0"]}, + {"Name": "delta", "Characters": ["0xce", "0xb4"]}, + {"Name": "demptyv", "Characters": ["0xe2", "0xa6", "0xb1"]}, + {"Name": "dfisht", "Characters": ["0xe2", "0xa5", "0xbf"]}, + {"Name": "dfr", "Characters": ["0xf0", "0x9d", "0x94", "0xa1"]}, + {"Name": "dharl", "Characters": ["0xe2", "0x87", "0x83"]}, + {"Name": "dharr", "Characters": ["0xe2", "0x87", "0x82"]}, + {"Name": "diam", "Characters": ["0xe2", "0x8b", "0x84"]}, + {"Name": "diamond", "Characters": ["0xe2", "0x8b", "0x84"]}, + {"Name": "diamondsuit", "Characters": ["0xe2", "0x99", "0xa6"]}, + {"Name": "diams", "Characters": ["0xe2", "0x99", "0xa6"]}, + {"Name": "die", "Characters": ["0xc2", "0xa8"]}, + {"Name": "digamma", "Characters": ["0xcf", "0x9d"]}, + {"Name": "disin", "Characters": ["0xe2", "0x8b", "0xb2"]}, + {"Name": "div", "Characters": ["0xc3", "0xb7"]}, + {"Name": "divide", "Characters": ["0xc3", "0xb7"]}, + {"Name": "divideontimes", "Characters": ["0xe2", "0x8b", "0x87"]}, + {"Name": "divonx", "Characters": ["0xe2", "0x8b", "0x87"]}, + {"Name": "djcy", "Characters": ["0xd1", "0x92"]}, + {"Name": "dlcorn", "Characters": ["0xe2", "0x8c", "0x9e"]}, + {"Name": "dlcrop", "Characters": ["0xe2", "0x8c", "0x8d"]}, + {"Name": "dollar", "Characters": ["0x24"]}, + {"Name": "dopf", "Characters": ["0xf0", "0x9d", "0x95", "0x95"]}, + {"Name": "dot", "Characters": ["0xcb", "0x99"]}, + {"Name": "doteq", "Characters": ["0xe2", "0x89", "0x90"]}, + {"Name": "doteqdot", "Characters": ["0xe2", "0x89", "0x91"]}, + {"Name": "dotminus", "Characters": ["0xe2", "0x88", "0xb8"]}, + {"Name": "dotplus", "Characters": ["0xe2", "0x88", "0x94"]}, + {"Name": "dotsquare", "Characters": ["0xe2", "0x8a", "0xa1"]}, + {"Name": "doublebarwedge", "Characters": ["0xe2", "0x8c", "0x86"]}, + {"Name": "downarrow", "Characters": ["0xe2", "0x86", "0x93"]}, + {"Name": "downdownarrows", "Characters": ["0xe2", "0x87", "0x8a"]}, + {"Name": "downharpoonleft", "Characters": ["0xe2", "0x87", "0x83"]}, + {"Name": "downharpoonright", "Characters": ["0xe2", "0x87", "0x82"]}, + {"Name": "drbkarow", "Characters": ["0xe2", "0xa4", "0x90"]}, + {"Name": "drcorn", "Characters": ["0xe2", "0x8c", "0x9f"]}, + {"Name": "drcrop", "Characters": ["0xe2", "0x8c", "0x8c"]}, + {"Name": "dscr", "Characters": ["0xf0", "0x9d", "0x92", "0xb9"]}, + {"Name": "dscy", "Characters": ["0xd1", "0x95"]}, + {"Name": "dsol", "Characters": ["0xe2", "0xa7", "0xb6"]}, + {"Name": "dstrok", "Characters": ["0xc4", "0x91"]}, + {"Name": "dtdot", "Characters": ["0xe2", "0x8b", "0xb1"]}, + {"Name": "dtri", "Characters": ["0xe2", "0x96", "0xbf"]}, + {"Name": "dtrif", "Characters": ["0xe2", "0x96", "0xbe"]}, + {"Name": "duarr", "Characters": ["0xe2", "0x87", "0xb5"]}, + {"Name": "duhar", "Characters": ["0xe2", "0xa5", "0xaf"]}, + {"Name": "dwangle", "Characters": ["0xe2", "0xa6", "0xa6"]}, + {"Name": "dzcy", "Characters": ["0xd1", "0x9f"]}, + {"Name": "dzigrarr", "Characters": ["0xe2", "0x9f", "0xbf"]}, + {"Name": "eDDot", "Characters": ["0xe2", "0xa9", "0xb7"]}, + {"Name": "eDot", "Characters": ["0xe2", "0x89", "0x91"]}, + {"Name": "eacute", "Characters": ["0xc3", "0xa9"]}, + {"Name": "easter", "Characters": ["0xe2", "0xa9", "0xae"]}, + {"Name": "ecaron", "Characters": ["0xc4", "0x9b"]}, + {"Name": "ecir", "Characters": ["0xe2", "0x89", "0x96"]}, + {"Name": "ecirc", "Characters": ["0xc3", "0xaa"]}, + {"Name": "ecolon", "Characters": ["0xe2", "0x89", "0x95"]}, + {"Name": "ecy", "Characters": ["0xd1", "0x8d"]}, + {"Name": "edot", "Characters": ["0xc4", "0x97"]}, + {"Name": "ee", "Characters": ["0xe2", "0x85", "0x87"]}, + {"Name": "efDot", "Characters": ["0xe2", "0x89", "0x92"]}, + {"Name": "efr", "Characters": ["0xf0", "0x9d", "0x94", "0xa2"]}, + {"Name": "eg", "Characters": ["0xe2", "0xaa", "0x9a"]}, + {"Name": "egrave", "Characters": ["0xc3", "0xa8"]}, + {"Name": "egs", "Characters": ["0xe2", "0xaa", "0x96"]}, + {"Name": "egsdot", "Characters": ["0xe2", "0xaa", "0x98"]}, + {"Name": "el", "Characters": ["0xe2", "0xaa", "0x99"]}, + {"Name": "elinters", "Characters": ["0xe2", "0x8f", "0xa7"]}, + {"Name": "ell", "Characters": ["0xe2", "0x84", "0x93"]}, + {"Name": "els", "Characters": ["0xe2", "0xaa", "0x95"]}, + {"Name": "elsdot", "Characters": ["0xe2", "0xaa", "0x97"]}, + {"Name": "emacr", "Characters": ["0xc4", "0x93"]}, + {"Name": "empty", "Characters": ["0xe2", "0x88", "0x85"]}, + {"Name": "emptyset", "Characters": ["0xe2", "0x88", "0x85"]}, + {"Name": "emptyv", "Characters": ["0xe2", "0x88", "0x85"]}, + {"Name": "emsp", "Characters": ["0xe2", "0x80", "0x83"]}, + {"Name": "emsp13", "Characters": ["0xe2", "0x80", "0x84"]}, + {"Name": "emsp14", "Characters": ["0xe2", "0x80", "0x85"]}, + {"Name": "eng", "Characters": ["0xc5", "0x8b"]}, + {"Name": "ensp", "Characters": ["0xe2", "0x80", "0x82"]}, + {"Name": "eogon", "Characters": ["0xc4", "0x99"]}, + {"Name": "eopf", "Characters": ["0xf0", "0x9d", "0x95", "0x96"]}, + {"Name": "epar", "Characters": ["0xe2", "0x8b", "0x95"]}, + {"Name": "eparsl", "Characters": ["0xe2", "0xa7", "0xa3"]}, + {"Name": "eplus", "Characters": ["0xe2", "0xa9", "0xb1"]}, + {"Name": "epsi", "Characters": ["0xce", "0xb5"]}, + {"Name": "epsilon", "Characters": ["0xce", "0xb5"]}, + {"Name": "epsiv", "Characters": ["0xcf", "0xb5"]}, + {"Name": "eqcirc", "Characters": ["0xe2", "0x89", "0x96"]}, + {"Name": "eqcolon", "Characters": ["0xe2", "0x89", "0x95"]}, + {"Name": "eqsim", "Characters": ["0xe2", "0x89", "0x82"]}, + {"Name": "eqslantgtr", "Characters": ["0xe2", "0xaa", "0x96"]}, + {"Name": "eqslantless", "Characters": ["0xe2", "0xaa", "0x95"]}, + {"Name": "equals", "Characters": ["0x3d"]}, + {"Name": "equest", "Characters": ["0xe2", "0x89", "0x9f"]}, + {"Name": "equiv", "Characters": ["0xe2", "0x89", "0xa1"]}, + {"Name": "equivDD", "Characters": ["0xe2", "0xa9", "0xb8"]}, + {"Name": "eqvparsl", "Characters": ["0xe2", "0xa7", "0xa5"]}, + {"Name": "erDot", "Characters": ["0xe2", "0x89", "0x93"]}, + {"Name": "erarr", "Characters": ["0xe2", "0xa5", "0xb1"]}, + {"Name": "escr", "Characters": ["0xe2", "0x84", "0xaf"]}, + {"Name": "esdot", "Characters": ["0xe2", "0x89", "0x90"]}, + {"Name": "esim", "Characters": ["0xe2", "0x89", "0x82"]}, + {"Name": "eta", "Characters": ["0xce", "0xb7"]}, + {"Name": "eth", "Characters": ["0xc3", "0xb0"]}, + {"Name": "euml", "Characters": ["0xc3", "0xab"]}, + {"Name": "euro", "Characters": ["0xe2", "0x82", "0xac"]}, + {"Name": "excl", "Characters": ["0x21"]}, + {"Name": "exist", "Characters": ["0xe2", "0x88", "0x83"]}, + {"Name": "expectation", "Characters": ["0xe2", "0x84", "0xb0"]}, + {"Name": "exponentiale", "Characters": ["0xe2", "0x85", "0x87"]}, + {"Name": "fallingdotseq", "Characters": ["0xe2", "0x89", "0x92"]}, + {"Name": "fcy", "Characters": ["0xd1", "0x84"]}, + {"Name": "female", "Characters": ["0xe2", "0x99", "0x80"]}, + {"Name": "ffilig", "Characters": ["0xef", "0xac", "0x83"]}, + {"Name": "fflig", "Characters": ["0xef", "0xac", "0x80"]}, + {"Name": "ffllig", "Characters": ["0xef", "0xac", "0x84"]}, + {"Name": "ffr", "Characters": ["0xf0", "0x9d", "0x94", "0xa3"]}, + {"Name": "filig", "Characters": ["0xef", "0xac", "0x81"]}, + {"Name": "fjlig", "Characters": ["0x66", "0x6a"]}, + {"Name": "flat", "Characters": ["0xe2", "0x99", "0xad"]}, + {"Name": "fllig", "Characters": ["0xef", "0xac", "0x82"]}, + {"Name": "fltns", "Characters": ["0xe2", "0x96", "0xb1"]}, + {"Name": "fnof", "Characters": ["0xc6", "0x92"]}, + {"Name": "fopf", "Characters": ["0xf0", "0x9d", "0x95", "0x97"]}, + {"Name": "forall", "Characters": ["0xe2", "0x88", "0x80"]}, + {"Name": "fork", "Characters": ["0xe2", "0x8b", "0x94"]}, + {"Name": "forkv", "Characters": ["0xe2", "0xab", "0x99"]}, + {"Name": "fpartint", "Characters": ["0xe2", "0xa8", "0x8d"]}, + {"Name": "frac12", "Characters": ["0xc2", "0xbd"]}, + {"Name": "frac13", "Characters": ["0xe2", "0x85", "0x93"]}, + {"Name": "frac14", "Characters": ["0xc2", "0xbc"]}, + {"Name": "frac15", "Characters": ["0xe2", "0x85", "0x95"]}, + {"Name": "frac16", "Characters": ["0xe2", "0x85", "0x99"]}, + {"Name": "frac18", "Characters": ["0xe2", "0x85", "0x9b"]}, + {"Name": "frac23", "Characters": ["0xe2", "0x85", "0x94"]}, + {"Name": "frac25", "Characters": ["0xe2", "0x85", "0x96"]}, + {"Name": "frac34", "Characters": ["0xc2", "0xbe"]}, + {"Name": "frac35", "Characters": ["0xe2", "0x85", "0x97"]}, + {"Name": "frac38", "Characters": ["0xe2", "0x85", "0x9c"]}, + {"Name": "frac45", "Characters": ["0xe2", "0x85", "0x98"]}, + {"Name": "frac56", "Characters": ["0xe2", "0x85", "0x9a"]}, + {"Name": "frac58", "Characters": ["0xe2", "0x85", "0x9d"]}, + {"Name": "frac78", "Characters": ["0xe2", "0x85", "0x9e"]}, + {"Name": "frasl", "Characters": ["0xe2", "0x81", "0x84"]}, + {"Name": "frown", "Characters": ["0xe2", "0x8c", "0xa2"]}, + {"Name": "fscr", "Characters": ["0xf0", "0x9d", "0x92", "0xbb"]}, + {"Name": "gE", "Characters": ["0xe2", "0x89", "0xa7"]}, + {"Name": "gEl", "Characters": ["0xe2", "0xaa", "0x8c"]}, + {"Name": "gacute", "Characters": ["0xc7", "0xb5"]}, + {"Name": "gamma", "Characters": ["0xce", "0xb3"]}, + {"Name": "gammad", "Characters": ["0xcf", "0x9d"]}, + {"Name": "gap", "Characters": ["0xe2", "0xaa", "0x86"]}, + {"Name": "gbreve", "Characters": ["0xc4", "0x9f"]}, + {"Name": "gcirc", "Characters": ["0xc4", "0x9d"]}, + {"Name": "gcy", "Characters": ["0xd0", "0xb3"]}, + {"Name": "gdot", "Characters": ["0xc4", "0xa1"]}, + {"Name": "ge", "Characters": ["0xe2", "0x89", "0xa5"]}, + {"Name": "gel", "Characters": ["0xe2", "0x8b", "0x9b"]}, + {"Name": "geq", "Characters": ["0xe2", "0x89", "0xa5"]}, + {"Name": "geqq", "Characters": ["0xe2", "0x89", "0xa7"]}, + {"Name": "geqslant", "Characters": ["0xe2", "0xa9", "0xbe"]}, + {"Name": "ges", "Characters": ["0xe2", "0xa9", "0xbe"]}, + {"Name": "gescc", "Characters": ["0xe2", "0xaa", "0xa9"]}, + {"Name": "gesdot", "Characters": ["0xe2", "0xaa", "0x80"]}, + {"Name": "gesdoto", "Characters": ["0xe2", "0xaa", "0x82"]}, + {"Name": "gesdotol", "Characters": ["0xe2", "0xaa", "0x84"]}, + {"Name": "gesl", "Characters": ["0xe2", "0x8b", "0x9b", "0xef", "0xb8", "0x80"]}, + {"Name": "gesles", "Characters": ["0xe2", "0xaa", "0x94"]}, + {"Name": "gfr", "Characters": ["0xf0", "0x9d", "0x94", "0xa4"]}, + {"Name": "gg", "Characters": ["0xe2", "0x89", "0xab"]}, + {"Name": "ggg", "Characters": ["0xe2", "0x8b", "0x99"]}, + {"Name": "gimel", "Characters": ["0xe2", "0x84", "0xb7"]}, + {"Name": "gjcy", "Characters": ["0xd1", "0x93"]}, + {"Name": "gl", "Characters": ["0xe2", "0x89", "0xb7"]}, + {"Name": "glE", "Characters": ["0xe2", "0xaa", "0x92"]}, + {"Name": "gla", "Characters": ["0xe2", "0xaa", "0xa5"]}, + {"Name": "glj", "Characters": ["0xe2", "0xaa", "0xa4"]}, + {"Name": "gnE", "Characters": ["0xe2", "0x89", "0xa9"]}, + {"Name": "gnap", "Characters": ["0xe2", "0xaa", "0x8a"]}, + {"Name": "gnapprox", "Characters": ["0xe2", "0xaa", "0x8a"]}, + {"Name": "gne", "Characters": ["0xe2", "0xaa", "0x88"]}, + {"Name": "gneq", "Characters": ["0xe2", "0xaa", "0x88"]}, + {"Name": "gneqq", "Characters": ["0xe2", "0x89", "0xa9"]}, + {"Name": "gnsim", "Characters": ["0xe2", "0x8b", "0xa7"]}, + {"Name": "gopf", "Characters": ["0xf0", "0x9d", "0x95", "0x98"]}, + {"Name": "grave", "Characters": ["0x60"]}, + {"Name": "gscr", "Characters": ["0xe2", "0x84", "0x8a"]}, + {"Name": "gsim", "Characters": ["0xe2", "0x89", "0xb3"]}, + {"Name": "gsime", "Characters": ["0xe2", "0xaa", "0x8e"]}, + {"Name": "gsiml", "Characters": ["0xe2", "0xaa", "0x90"]}, + {"Name": "gt", "Characters": ["0x3e"]}, + {"Name": "gtcc", "Characters": ["0xe2", "0xaa", "0xa7"]}, + {"Name": "gtcir", "Characters": ["0xe2", "0xa9", "0xba"]}, + {"Name": "gtdot", "Characters": ["0xe2", "0x8b", "0x97"]}, + {"Name": "gtlPar", "Characters": ["0xe2", "0xa6", "0x95"]}, + {"Name": "gtquest", "Characters": ["0xe2", "0xa9", "0xbc"]}, + {"Name": "gtrapprox", "Characters": ["0xe2", "0xaa", "0x86"]}, + {"Name": "gtrarr", "Characters": ["0xe2", "0xa5", "0xb8"]}, + {"Name": "gtrdot", "Characters": ["0xe2", "0x8b", "0x97"]}, + {"Name": "gtreqless", "Characters": ["0xe2", "0x8b", "0x9b"]}, + {"Name": "gtreqqless", "Characters": ["0xe2", "0xaa", "0x8c"]}, + {"Name": "gtrless", "Characters": ["0xe2", "0x89", "0xb7"]}, + {"Name": "gtrsim", "Characters": ["0xe2", "0x89", "0xb3"]}, + {"Name": "gvertneqq", "Characters": ["0xe2", "0x89", "0xa9", "0xef", "0xb8", "0x80"]}, + {"Name": "gvnE", "Characters": ["0xe2", "0x89", "0xa9", "0xef", "0xb8", "0x80"]}, + {"Name": "hArr", "Characters": ["0xe2", "0x87", "0x94"]}, + {"Name": "hairsp", "Characters": ["0xe2", "0x80", "0x8a"]}, + {"Name": "half", "Characters": ["0xc2", "0xbd"]}, + {"Name": "hamilt", "Characters": ["0xe2", "0x84", "0x8b"]}, + {"Name": "hardcy", "Characters": ["0xd1", "0x8a"]}, + {"Name": "harr", "Characters": ["0xe2", "0x86", "0x94"]}, + {"Name": "harrcir", "Characters": ["0xe2", "0xa5", "0x88"]}, + {"Name": "harrw", "Characters": ["0xe2", "0x86", "0xad"]}, + {"Name": "hbar", "Characters": ["0xe2", "0x84", "0x8f"]}, + {"Name": "hcirc", "Characters": ["0xc4", "0xa5"]}, + {"Name": "hearts", "Characters": ["0xe2", "0x99", "0xa5"]}, + {"Name": "heartsuit", "Characters": ["0xe2", "0x99", "0xa5"]}, + {"Name": "hellip", "Characters": ["0xe2", "0x80", "0xa6"]}, + {"Name": "hercon", "Characters": ["0xe2", "0x8a", "0xb9"]}, + {"Name": "hfr", "Characters": ["0xf0", "0x9d", "0x94", "0xa5"]}, + {"Name": "hksearow", "Characters": ["0xe2", "0xa4", "0xa5"]}, + {"Name": "hkswarow", "Characters": ["0xe2", "0xa4", "0xa6"]}, + {"Name": "hoarr", "Characters": ["0xe2", "0x87", "0xbf"]}, + {"Name": "homtht", "Characters": ["0xe2", "0x88", "0xbb"]}, + {"Name": "hookleftarrow", "Characters": ["0xe2", "0x86", "0xa9"]}, + {"Name": "hookrightarrow", "Characters": ["0xe2", "0x86", "0xaa"]}, + {"Name": "hopf", "Characters": ["0xf0", "0x9d", "0x95", "0x99"]}, + {"Name": "horbar", "Characters": ["0xe2", "0x80", "0x95"]}, + {"Name": "hscr", "Characters": ["0xf0", "0x9d", "0x92", "0xbd"]}, + {"Name": "hslash", "Characters": ["0xe2", "0x84", "0x8f"]}, + {"Name": "hstrok", "Characters": ["0xc4", "0xa7"]}, + {"Name": "hybull", "Characters": ["0xe2", "0x81", "0x83"]}, + {"Name": "hyphen", "Characters": ["0xe2", "0x80", "0x90"]}, + {"Name": "iacute", "Characters": ["0xc3", "0xad"]}, + {"Name": "ic", "Characters": ["0xe2", "0x81", "0xa3"]}, + {"Name": "icirc", "Characters": ["0xc3", "0xae"]}, + {"Name": "icy", "Characters": ["0xd0", "0xb8"]}, + {"Name": "iecy", "Characters": ["0xd0", "0xb5"]}, + {"Name": "iexcl", "Characters": ["0xc2", "0xa1"]}, + {"Name": "iff", "Characters": ["0xe2", "0x87", "0x94"]}, + {"Name": "ifr", "Characters": ["0xf0", "0x9d", "0x94", "0xa6"]}, + {"Name": "igrave", "Characters": ["0xc3", "0xac"]}, + {"Name": "ii", "Characters": ["0xe2", "0x85", "0x88"]}, + {"Name": "iiiint", "Characters": ["0xe2", "0xa8", "0x8c"]}, + {"Name": "iiint", "Characters": ["0xe2", "0x88", "0xad"]}, + {"Name": "iinfin", "Characters": ["0xe2", "0xa7", "0x9c"]}, + {"Name": "iiota", "Characters": ["0xe2", "0x84", "0xa9"]}, + {"Name": "ijlig", "Characters": ["0xc4", "0xb3"]}, + {"Name": "imacr", "Characters": ["0xc4", "0xab"]}, + {"Name": "image", "Characters": ["0xe2", "0x84", "0x91"]}, + {"Name": "imagline", "Characters": ["0xe2", "0x84", "0x90"]}, + {"Name": "imagpart", "Characters": ["0xe2", "0x84", "0x91"]}, + {"Name": "imath", "Characters": ["0xc4", "0xb1"]}, + {"Name": "imof", "Characters": ["0xe2", "0x8a", "0xb7"]}, + {"Name": "imped", "Characters": ["0xc6", "0xb5"]}, + {"Name": "in", "Characters": ["0xe2", "0x88", "0x88"]}, + {"Name": "incare", "Characters": ["0xe2", "0x84", "0x85"]}, + {"Name": "infin", "Characters": ["0xe2", "0x88", "0x9e"]}, + {"Name": "infintie", "Characters": ["0xe2", "0xa7", "0x9d"]}, + {"Name": "inodot", "Characters": ["0xc4", "0xb1"]}, + {"Name": "int", "Characters": ["0xe2", "0x88", "0xab"]}, + {"Name": "intcal", "Characters": ["0xe2", "0x8a", "0xba"]}, + {"Name": "integers", "Characters": ["0xe2", "0x84", "0xa4"]}, + {"Name": "intercal", "Characters": ["0xe2", "0x8a", "0xba"]}, + {"Name": "intlarhk", "Characters": ["0xe2", "0xa8", "0x97"]}, + {"Name": "intprod", "Characters": ["0xe2", "0xa8", "0xbc"]}, + {"Name": "iocy", "Characters": ["0xd1", "0x91"]}, + {"Name": "iogon", "Characters": ["0xc4", "0xaf"]}, + {"Name": "iopf", "Characters": ["0xf0", "0x9d", "0x95", "0x9a"]}, + {"Name": "iota", "Characters": ["0xce", "0xb9"]}, + {"Name": "iprod", "Characters": ["0xe2", "0xa8", "0xbc"]}, + {"Name": "iquest", "Characters": ["0xc2", "0xbf"]}, + {"Name": "iscr", "Characters": ["0xf0", "0x9d", "0x92", "0xbe"]}, + {"Name": "isin", "Characters": ["0xe2", "0x88", "0x88"]}, + {"Name": "isinE", "Characters": ["0xe2", "0x8b", "0xb9"]}, + {"Name": "isindot", "Characters": ["0xe2", "0x8b", "0xb5"]}, + {"Name": "isins", "Characters": ["0xe2", "0x8b", "0xb4"]}, + {"Name": "isinsv", "Characters": ["0xe2", "0x8b", "0xb3"]}, + {"Name": "isinv", "Characters": ["0xe2", "0x88", "0x88"]}, + {"Name": "it", "Characters": ["0xe2", "0x81", "0xa2"]}, + {"Name": "itilde", "Characters": ["0xc4", "0xa9"]}, + {"Name": "iukcy", "Characters": ["0xd1", "0x96"]}, + {"Name": "iuml", "Characters": ["0xc3", "0xaf"]}, + {"Name": "jcirc", "Characters": ["0xc4", "0xb5"]}, + {"Name": "jcy", "Characters": ["0xd0", "0xb9"]}, + {"Name": "jfr", "Characters": ["0xf0", "0x9d", "0x94", "0xa7"]}, + {"Name": "jmath", "Characters": ["0xc8", "0xb7"]}, + {"Name": "jopf", "Characters": ["0xf0", "0x9d", "0x95", "0x9b"]}, + {"Name": "jscr", "Characters": ["0xf0", "0x9d", "0x92", "0xbf"]}, + {"Name": "jsercy", "Characters": ["0xd1", "0x98"]}, + {"Name": "jukcy", "Characters": ["0xd1", "0x94"]}, + {"Name": "kappa", "Characters": ["0xce", "0xba"]}, + {"Name": "kappav", "Characters": ["0xcf", "0xb0"]}, + {"Name": "kcedil", "Characters": ["0xc4", "0xb7"]}, + {"Name": "kcy", "Characters": ["0xd0", "0xba"]}, + {"Name": "kfr", "Characters": ["0xf0", "0x9d", "0x94", "0xa8"]}, + {"Name": "kgreen", "Characters": ["0xc4", "0xb8"]}, + {"Name": "khcy", "Characters": ["0xd1", "0x85"]}, + {"Name": "kjcy", "Characters": ["0xd1", "0x9c"]}, + {"Name": "kopf", "Characters": ["0xf0", "0x9d", "0x95", "0x9c"]}, + {"Name": "kscr", "Characters": ["0xf0", "0x9d", "0x93", "0x80"]}, + {"Name": "lAarr", "Characters": ["0xe2", "0x87", "0x9a"]}, + {"Name": "lArr", "Characters": ["0xe2", "0x87", "0x90"]}, + {"Name": "lAtail", "Characters": ["0xe2", "0xa4", "0x9b"]}, + {"Name": "lBarr", "Characters": ["0xe2", "0xa4", "0x8e"]}, + {"Name": "lE", "Characters": ["0xe2", "0x89", "0xa6"]}, + {"Name": "lEg", "Characters": ["0xe2", "0xaa", "0x8b"]}, + {"Name": "lHar", "Characters": ["0xe2", "0xa5", "0xa2"]}, + {"Name": "lacute", "Characters": ["0xc4", "0xba"]}, + {"Name": "laemptyv", "Characters": ["0xe2", "0xa6", "0xb4"]}, + {"Name": "lagran", "Characters": ["0xe2", "0x84", "0x92"]}, + {"Name": "lambda", "Characters": ["0xce", "0xbb"]}, + {"Name": "lang", "Characters": ["0xe2", "0x9f", "0xa8"]}, + {"Name": "langd", "Characters": ["0xe2", "0xa6", "0x91"]}, + {"Name": "langle", "Characters": ["0xe2", "0x9f", "0xa8"]}, + {"Name": "lap", "Characters": ["0xe2", "0xaa", "0x85"]}, + {"Name": "laquo", "Characters": ["0xc2", "0xab"]}, + {"Name": "larr", "Characters": ["0xe2", "0x86", "0x90"]}, + {"Name": "larrb", "Characters": ["0xe2", "0x87", "0xa4"]}, + {"Name": "larrbfs", "Characters": ["0xe2", "0xa4", "0x9f"]}, + {"Name": "larrfs", "Characters": ["0xe2", "0xa4", "0x9d"]}, + {"Name": "larrhk", "Characters": ["0xe2", "0x86", "0xa9"]}, + {"Name": "larrlp", "Characters": ["0xe2", "0x86", "0xab"]}, + {"Name": "larrpl", "Characters": ["0xe2", "0xa4", "0xb9"]}, + {"Name": "larrsim", "Characters": ["0xe2", "0xa5", "0xb3"]}, + {"Name": "larrtl", "Characters": ["0xe2", "0x86", "0xa2"]}, + {"Name": "lat", "Characters": ["0xe2", "0xaa", "0xab"]}, + {"Name": "latail", "Characters": ["0xe2", "0xa4", "0x99"]}, + {"Name": "late", "Characters": ["0xe2", "0xaa", "0xad"]}, + {"Name": "lates", "Characters": ["0xe2", "0xaa", "0xad", "0xef", "0xb8", "0x80"]}, + {"Name": "lbarr", "Characters": ["0xe2", "0xa4", "0x8c"]}, + {"Name": "lbbrk", "Characters": ["0xe2", "0x9d", "0xb2"]}, + {"Name": "lbrace", "Characters": ["0x7b"]}, + {"Name": "lbrack", "Characters": ["0x5b"]}, + {"Name": "lbrke", "Characters": ["0xe2", "0xa6", "0x8b"]}, + {"Name": "lbrksld", "Characters": ["0xe2", "0xa6", "0x8f"]}, + {"Name": "lbrkslu", "Characters": ["0xe2", "0xa6", "0x8d"]}, + {"Name": "lcaron", "Characters": ["0xc4", "0xbe"]}, + {"Name": "lcedil", "Characters": ["0xc4", "0xbc"]}, + {"Name": "lceil", "Characters": ["0xe2", "0x8c", "0x88"]}, + {"Name": "lcub", "Characters": ["0x7b"]}, + {"Name": "lcy", "Characters": ["0xd0", "0xbb"]}, + {"Name": "ldca", "Characters": ["0xe2", "0xa4", "0xb6"]}, + {"Name": "ldquo", "Characters": ["0xe2", "0x80", "0x9c"]}, + {"Name": "ldquor", "Characters": ["0xe2", "0x80", "0x9e"]}, + {"Name": "ldrdhar", "Characters": ["0xe2", "0xa5", "0xa7"]}, + {"Name": "ldrushar", "Characters": ["0xe2", "0xa5", "0x8b"]}, + {"Name": "ldsh", "Characters": ["0xe2", "0x86", "0xb2"]}, + {"Name": "le", "Characters": ["0xe2", "0x89", "0xa4"]}, + {"Name": "leftarrow", "Characters": ["0xe2", "0x86", "0x90"]}, + {"Name": "leftarrowtail", "Characters": ["0xe2", "0x86", "0xa2"]}, + {"Name": "leftharpoondown", "Characters": ["0xe2", "0x86", "0xbd"]}, + {"Name": "leftharpoonup", "Characters": ["0xe2", "0x86", "0xbc"]}, + {"Name": "leftleftarrows", "Characters": ["0xe2", "0x87", "0x87"]}, + {"Name": "leftrightarrow", "Characters": ["0xe2", "0x86", "0x94"]}, + {"Name": "leftrightarrows", "Characters": ["0xe2", "0x87", "0x86"]}, + {"Name": "leftrightharpoons", "Characters": ["0xe2", "0x87", "0x8b"]}, + {"Name": "leftrightsquigarrow", "Characters": ["0xe2", "0x86", "0xad"]}, + {"Name": "leftthreetimes", "Characters": ["0xe2", "0x8b", "0x8b"]}, + {"Name": "leg", "Characters": ["0xe2", "0x8b", "0x9a"]}, + {"Name": "leq", "Characters": ["0xe2", "0x89", "0xa4"]}, + {"Name": "leqq", "Characters": ["0xe2", "0x89", "0xa6"]}, + {"Name": "leqslant", "Characters": ["0xe2", "0xa9", "0xbd"]}, + {"Name": "les", "Characters": ["0xe2", "0xa9", "0xbd"]}, + {"Name": "lescc", "Characters": ["0xe2", "0xaa", "0xa8"]}, + {"Name": "lesdot", "Characters": ["0xe2", "0xa9", "0xbf"]}, + {"Name": "lesdoto", "Characters": ["0xe2", "0xaa", "0x81"]}, + {"Name": "lesdotor", "Characters": ["0xe2", "0xaa", "0x83"]}, + {"Name": "lesg", "Characters": ["0xe2", "0x8b", "0x9a", "0xef", "0xb8", "0x80"]}, + {"Name": "lesges", "Characters": ["0xe2", "0xaa", "0x93"]}, + {"Name": "lessapprox", "Characters": ["0xe2", "0xaa", "0x85"]}, + {"Name": "lessdot", "Characters": ["0xe2", "0x8b", "0x96"]}, + {"Name": "lesseqgtr", "Characters": ["0xe2", "0x8b", "0x9a"]}, + {"Name": "lesseqqgtr", "Characters": ["0xe2", "0xaa", "0x8b"]}, + {"Name": "lessgtr", "Characters": ["0xe2", "0x89", "0xb6"]}, + {"Name": "lesssim", "Characters": ["0xe2", "0x89", "0xb2"]}, + {"Name": "lfisht", "Characters": ["0xe2", "0xa5", "0xbc"]}, + {"Name": "lfloor", "Characters": ["0xe2", "0x8c", "0x8a"]}, + {"Name": "lfr", "Characters": ["0xf0", "0x9d", "0x94", "0xa9"]}, + {"Name": "lg", "Characters": ["0xe2", "0x89", "0xb6"]}, + {"Name": "lgE", "Characters": ["0xe2", "0xaa", "0x91"]}, + {"Name": "lhard", "Characters": ["0xe2", "0x86", "0xbd"]}, + {"Name": "lharu", "Characters": ["0xe2", "0x86", "0xbc"]}, + {"Name": "lharul", "Characters": ["0xe2", "0xa5", "0xaa"]}, + {"Name": "lhblk", "Characters": ["0xe2", "0x96", "0x84"]}, + {"Name": "ljcy", "Characters": ["0xd1", "0x99"]}, + {"Name": "ll", "Characters": ["0xe2", "0x89", "0xaa"]}, + {"Name": "llarr", "Characters": ["0xe2", "0x87", "0x87"]}, + {"Name": "llcorner", "Characters": ["0xe2", "0x8c", "0x9e"]}, + {"Name": "llhard", "Characters": ["0xe2", "0xa5", "0xab"]}, + {"Name": "lltri", "Characters": ["0xe2", "0x97", "0xba"]}, + {"Name": "lmidot", "Characters": ["0xc5", "0x80"]}, + {"Name": "lmoust", "Characters": ["0xe2", "0x8e", "0xb0"]}, + {"Name": "lmoustache", "Characters": ["0xe2", "0x8e", "0xb0"]}, + {"Name": "lnE", "Characters": ["0xe2", "0x89", "0xa8"]}, + {"Name": "lnap", "Characters": ["0xe2", "0xaa", "0x89"]}, + {"Name": "lnapprox", "Characters": ["0xe2", "0xaa", "0x89"]}, + {"Name": "lne", "Characters": ["0xe2", "0xaa", "0x87"]}, + {"Name": "lneq", "Characters": ["0xe2", "0xaa", "0x87"]}, + {"Name": "lneqq", "Characters": ["0xe2", "0x89", "0xa8"]}, + {"Name": "lnsim", "Characters": ["0xe2", "0x8b", "0xa6"]}, + {"Name": "loang", "Characters": ["0xe2", "0x9f", "0xac"]}, + {"Name": "loarr", "Characters": ["0xe2", "0x87", "0xbd"]}, + {"Name": "lobrk", "Characters": ["0xe2", "0x9f", "0xa6"]}, + {"Name": "longleftarrow", "Characters": ["0xe2", "0x9f", "0xb5"]}, + {"Name": "longleftrightarrow", "Characters": ["0xe2", "0x9f", "0xb7"]}, + {"Name": "longmapsto", "Characters": ["0xe2", "0x9f", "0xbc"]}, + {"Name": "longrightarrow", "Characters": ["0xe2", "0x9f", "0xb6"]}, + {"Name": "looparrowleft", "Characters": ["0xe2", "0x86", "0xab"]}, + {"Name": "looparrowright", "Characters": ["0xe2", "0x86", "0xac"]}, + {"Name": "lopar", "Characters": ["0xe2", "0xa6", "0x85"]}, + {"Name": "lopf", "Characters": ["0xf0", "0x9d", "0x95", "0x9d"]}, + {"Name": "loplus", "Characters": ["0xe2", "0xa8", "0xad"]}, + {"Name": "lotimes", "Characters": ["0xe2", "0xa8", "0xb4"]}, + {"Name": "lowast", "Characters": ["0xe2", "0x88", "0x97"]}, + {"Name": "lowbar", "Characters": ["0x5f"]}, + {"Name": "loz", "Characters": ["0xe2", "0x97", "0x8a"]}, + {"Name": "lozenge", "Characters": ["0xe2", "0x97", "0x8a"]}, + {"Name": "lozf", "Characters": ["0xe2", "0xa7", "0xab"]}, + {"Name": "lpar", "Characters": ["0x28"]}, + {"Name": "lparlt", "Characters": ["0xe2", "0xa6", "0x93"]}, + {"Name": "lrarr", "Characters": ["0xe2", "0x87", "0x86"]}, + {"Name": "lrcorner", "Characters": ["0xe2", "0x8c", "0x9f"]}, + {"Name": "lrhar", "Characters": ["0xe2", "0x87", "0x8b"]}, + {"Name": "lrhard", "Characters": ["0xe2", "0xa5", "0xad"]}, + {"Name": "lrm", "Characters": ["0xe2", "0x80", "0x8e"]}, + {"Name": "lrtri", "Characters": ["0xe2", "0x8a", "0xbf"]}, + {"Name": "lsaquo", "Characters": ["0xe2", "0x80", "0xb9"]}, + {"Name": "lscr", "Characters": ["0xf0", "0x9d", "0x93", "0x81"]}, + {"Name": "lsh", "Characters": ["0xe2", "0x86", "0xb0"]}, + {"Name": "lsim", "Characters": ["0xe2", "0x89", "0xb2"]}, + {"Name": "lsime", "Characters": ["0xe2", "0xaa", "0x8d"]}, + {"Name": "lsimg", "Characters": ["0xe2", "0xaa", "0x8f"]}, + {"Name": "lsqb", "Characters": ["0x5b"]}, + {"Name": "lsquo", "Characters": ["0xe2", "0x80", "0x98"]}, + {"Name": "lsquor", "Characters": ["0xe2", "0x80", "0x9a"]}, + {"Name": "lstrok", "Characters": ["0xc5", "0x82"]}, + {"Name": "lt", "Characters": ["0x3c"]}, + {"Name": "ltcc", "Characters": ["0xe2", "0xaa", "0xa6"]}, + {"Name": "ltcir", "Characters": ["0xe2", "0xa9", "0xb9"]}, + {"Name": "ltdot", "Characters": ["0xe2", "0x8b", "0x96"]}, + {"Name": "lthree", "Characters": ["0xe2", "0x8b", "0x8b"]}, + {"Name": "ltimes", "Characters": ["0xe2", "0x8b", "0x89"]}, + {"Name": "ltlarr", "Characters": ["0xe2", "0xa5", "0xb6"]}, + {"Name": "ltquest", "Characters": ["0xe2", "0xa9", "0xbb"]}, + {"Name": "ltrPar", "Characters": ["0xe2", "0xa6", "0x96"]}, + {"Name": "ltri", "Characters": ["0xe2", "0x97", "0x83"]}, + {"Name": "ltrie", "Characters": ["0xe2", "0x8a", "0xb4"]}, + {"Name": "ltrif", "Characters": ["0xe2", "0x97", "0x82"]}, + {"Name": "lurdshar", "Characters": ["0xe2", "0xa5", "0x8a"]}, + {"Name": "luruhar", "Characters": ["0xe2", "0xa5", "0xa6"]}, + {"Name": "lvertneqq", "Characters": ["0xe2", "0x89", "0xa8", "0xef", "0xb8", "0x80"]}, + {"Name": "lvnE", "Characters": ["0xe2", "0x89", "0xa8", "0xef", "0xb8", "0x80"]}, + {"Name": "mDDot", "Characters": ["0xe2", "0x88", "0xba"]}, + {"Name": "macr", "Characters": ["0xc2", "0xaf"]}, + {"Name": "male", "Characters": ["0xe2", "0x99", "0x82"]}, + {"Name": "malt", "Characters": ["0xe2", "0x9c", "0xa0"]}, + {"Name": "maltese", "Characters": ["0xe2", "0x9c", "0xa0"]}, + {"Name": "map", "Characters": ["0xe2", "0x86", "0xa6"]}, + {"Name": "mapsto", "Characters": ["0xe2", "0x86", "0xa6"]}, + {"Name": "mapstodown", "Characters": ["0xe2", "0x86", "0xa7"]}, + {"Name": "mapstoleft", "Characters": ["0xe2", "0x86", "0xa4"]}, + {"Name": "mapstoup", "Characters": ["0xe2", "0x86", "0xa5"]}, + {"Name": "marker", "Characters": ["0xe2", "0x96", "0xae"]}, + {"Name": "mcomma", "Characters": ["0xe2", "0xa8", "0xa9"]}, + {"Name": "mcy", "Characters": ["0xd0", "0xbc"]}, + {"Name": "mdash", "Characters": ["0xe2", "0x80", "0x94"]}, + {"Name": "measuredangle", "Characters": ["0xe2", "0x88", "0xa1"]}, + {"Name": "mfr", "Characters": ["0xf0", "0x9d", "0x94", "0xaa"]}, + {"Name": "mho", "Characters": ["0xe2", "0x84", "0xa7"]}, + {"Name": "micro", "Characters": ["0xc2", "0xb5"]}, + {"Name": "mid", "Characters": ["0xe2", "0x88", "0xa3"]}, + {"Name": "midast", "Characters": ["0x2a"]}, + {"Name": "midcir", "Characters": ["0xe2", "0xab", "0xb0"]}, + {"Name": "middot", "Characters": ["0xc2", "0xb7"]}, + {"Name": "minus", "Characters": ["0xe2", "0x88", "0x92"]}, + {"Name": "minusb", "Characters": ["0xe2", "0x8a", "0x9f"]}, + {"Name": "minusd", "Characters": ["0xe2", "0x88", "0xb8"]}, + {"Name": "minusdu", "Characters": ["0xe2", "0xa8", "0xaa"]}, + {"Name": "mlcp", "Characters": ["0xe2", "0xab", "0x9b"]}, + {"Name": "mldr", "Characters": ["0xe2", "0x80", "0xa6"]}, + {"Name": "mnplus", "Characters": ["0xe2", "0x88", "0x93"]}, + {"Name": "models", "Characters": ["0xe2", "0x8a", "0xa7"]}, + {"Name": "mopf", "Characters": ["0xf0", "0x9d", "0x95", "0x9e"]}, + {"Name": "mp", "Characters": ["0xe2", "0x88", "0x93"]}, + {"Name": "mscr", "Characters": ["0xf0", "0x9d", "0x93", "0x82"]}, + {"Name": "mstpos", "Characters": ["0xe2", "0x88", "0xbe"]}, + {"Name": "mu", "Characters": ["0xce", "0xbc"]}, + {"Name": "multimap", "Characters": ["0xe2", "0x8a", "0xb8"]}, + {"Name": "mumap", "Characters": ["0xe2", "0x8a", "0xb8"]}, + {"Name": "nGg", "Characters": ["0xe2", "0x8b", "0x99", "0xcc", "0xb8"]}, + {"Name": "nGt", "Characters": ["0xe2", "0x89", "0xab", "0xe2", "0x83", "0x92"]}, + {"Name": "nGtv", "Characters": ["0xe2", "0x89", "0xab", "0xcc", "0xb8"]}, + {"Name": "nLeftarrow", "Characters": ["0xe2", "0x87", "0x8d"]}, + {"Name": "nLeftrightarrow", "Characters": ["0xe2", "0x87", "0x8e"]}, + {"Name": "nLl", "Characters": ["0xe2", "0x8b", "0x98", "0xcc", "0xb8"]}, + {"Name": "nLt", "Characters": ["0xe2", "0x89", "0xaa", "0xe2", "0x83", "0x92"]}, + {"Name": "nLtv", "Characters": ["0xe2", "0x89", "0xaa", "0xcc", "0xb8"]}, + {"Name": "nRightarrow", "Characters": ["0xe2", "0x87", "0x8f"]}, + {"Name": "nVDash", "Characters": ["0xe2", "0x8a", "0xaf"]}, + {"Name": "nVdash", "Characters": ["0xe2", "0x8a", "0xae"]}, + {"Name": "nabla", "Characters": ["0xe2", "0x88", "0x87"]}, + {"Name": "nacute", "Characters": ["0xc5", "0x84"]}, + {"Name": "nang", "Characters": ["0xe2", "0x88", "0xa0", "0xe2", "0x83", "0x92"]}, + {"Name": "nap", "Characters": ["0xe2", "0x89", "0x89"]}, + {"Name": "napE", "Characters": ["0xe2", "0xa9", "0xb0", "0xcc", "0xb8"]}, + {"Name": "napid", "Characters": ["0xe2", "0x89", "0x8b", "0xcc", "0xb8"]}, + {"Name": "napos", "Characters": ["0xc5", "0x89"]}, + {"Name": "napprox", "Characters": ["0xe2", "0x89", "0x89"]}, + {"Name": "natur", "Characters": ["0xe2", "0x99", "0xae"]}, + {"Name": "natural", "Characters": ["0xe2", "0x99", "0xae"]}, + {"Name": "naturals", "Characters": ["0xe2", "0x84", "0x95"]}, + {"Name": "nbsp", "Characters": ["0xc2", "0xa0"]}, + {"Name": "nbump", "Characters": ["0xe2", "0x89", "0x8e", "0xcc", "0xb8"]}, + {"Name": "nbumpe", "Characters": ["0xe2", "0x89", "0x8f", "0xcc", "0xb8"]}, + {"Name": "ncap", "Characters": ["0xe2", "0xa9", "0x83"]}, + {"Name": "ncaron", "Characters": ["0xc5", "0x88"]}, + {"Name": "ncedil", "Characters": ["0xc5", "0x86"]}, + {"Name": "ncong", "Characters": ["0xe2", "0x89", "0x87"]}, + {"Name": "ncongdot", "Characters": ["0xe2", "0xa9", "0xad", "0xcc", "0xb8"]}, + {"Name": "ncup", "Characters": ["0xe2", "0xa9", "0x82"]}, + {"Name": "ncy", "Characters": ["0xd0", "0xbd"]}, + {"Name": "ndash", "Characters": ["0xe2", "0x80", "0x93"]}, + {"Name": "ne", "Characters": ["0xe2", "0x89", "0xa0"]}, + {"Name": "neArr", "Characters": ["0xe2", "0x87", "0x97"]}, + {"Name": "nearhk", "Characters": ["0xe2", "0xa4", "0xa4"]}, + {"Name": "nearr", "Characters": ["0xe2", "0x86", "0x97"]}, + {"Name": "nearrow", "Characters": ["0xe2", "0x86", "0x97"]}, + {"Name": "nedot", "Characters": ["0xe2", "0x89", "0x90", "0xcc", "0xb8"]}, + {"Name": "nequiv", "Characters": ["0xe2", "0x89", "0xa2"]}, + {"Name": "nesear", "Characters": ["0xe2", "0xa4", "0xa8"]}, + {"Name": "nesim", "Characters": ["0xe2", "0x89", "0x82", "0xcc", "0xb8"]}, + {"Name": "nexist", "Characters": ["0xe2", "0x88", "0x84"]}, + {"Name": "nexists", "Characters": ["0xe2", "0x88", "0x84"]}, + {"Name": "nfr", "Characters": ["0xf0", "0x9d", "0x94", "0xab"]}, + {"Name": "ngE", "Characters": ["0xe2", "0x89", "0xa7", "0xcc", "0xb8"]}, + {"Name": "nge", "Characters": ["0xe2", "0x89", "0xb1"]}, + {"Name": "ngeq", "Characters": ["0xe2", "0x89", "0xb1"]}, + {"Name": "ngeqq", "Characters": ["0xe2", "0x89", "0xa7", "0xcc", "0xb8"]}, + {"Name": "ngeqslant", "Characters": ["0xe2", "0xa9", "0xbe", "0xcc", "0xb8"]}, + {"Name": "nges", "Characters": ["0xe2", "0xa9", "0xbe", "0xcc", "0xb8"]}, + {"Name": "ngsim", "Characters": ["0xe2", "0x89", "0xb5"]}, + {"Name": "ngt", "Characters": ["0xe2", "0x89", "0xaf"]}, + {"Name": "ngtr", "Characters": ["0xe2", "0x89", "0xaf"]}, + {"Name": "nhArr", "Characters": ["0xe2", "0x87", "0x8e"]}, + {"Name": "nharr", "Characters": ["0xe2", "0x86", "0xae"]}, + {"Name": "nhpar", "Characters": ["0xe2", "0xab", "0xb2"]}, + {"Name": "ni", "Characters": ["0xe2", "0x88", "0x8b"]}, + {"Name": "nis", "Characters": ["0xe2", "0x8b", "0xbc"]}, + {"Name": "nisd", "Characters": ["0xe2", "0x8b", "0xba"]}, + {"Name": "niv", "Characters": ["0xe2", "0x88", "0x8b"]}, + {"Name": "njcy", "Characters": ["0xd1", "0x9a"]}, + {"Name": "nlArr", "Characters": ["0xe2", "0x87", "0x8d"]}, + {"Name": "nlE", "Characters": ["0xe2", "0x89", "0xa6", "0xcc", "0xb8"]}, + {"Name": "nlarr", "Characters": ["0xe2", "0x86", "0x9a"]}, + {"Name": "nldr", "Characters": ["0xe2", "0x80", "0xa5"]}, + {"Name": "nle", "Characters": ["0xe2", "0x89", "0xb0"]}, + {"Name": "nleftarrow", "Characters": ["0xe2", "0x86", "0x9a"]}, + {"Name": "nleftrightarrow", "Characters": ["0xe2", "0x86", "0xae"]}, + {"Name": "nleq", "Characters": ["0xe2", "0x89", "0xb0"]}, + {"Name": "nleqq", "Characters": ["0xe2", "0x89", "0xa6", "0xcc", "0xb8"]}, + {"Name": "nleqslant", "Characters": ["0xe2", "0xa9", "0xbd", "0xcc", "0xb8"]}, + {"Name": "nles", "Characters": ["0xe2", "0xa9", "0xbd", "0xcc", "0xb8"]}, + {"Name": "nless", "Characters": ["0xe2", "0x89", "0xae"]}, + {"Name": "nlsim", "Characters": ["0xe2", "0x89", "0xb4"]}, + {"Name": "nlt", "Characters": ["0xe2", "0x89", "0xae"]}, + {"Name": "nltri", "Characters": ["0xe2", "0x8b", "0xaa"]}, + {"Name": "nltrie", "Characters": ["0xe2", "0x8b", "0xac"]}, + {"Name": "nmid", "Characters": ["0xe2", "0x88", "0xa4"]}, + {"Name": "nopf", "Characters": ["0xf0", "0x9d", "0x95", "0x9f"]}, + {"Name": "not", "Characters": ["0xc2", "0xac"]}, + {"Name": "notin", "Characters": ["0xe2", "0x88", "0x89"]}, + {"Name": "notinE", "Characters": ["0xe2", "0x8b", "0xb9", "0xcc", "0xb8"]}, + {"Name": "notindot", "Characters": ["0xe2", "0x8b", "0xb5", "0xcc", "0xb8"]}, + {"Name": "notinva", "Characters": ["0xe2", "0x88", "0x89"]}, + {"Name": "notinvb", "Characters": ["0xe2", "0x8b", "0xb7"]}, + {"Name": "notinvc", "Characters": ["0xe2", "0x8b", "0xb6"]}, + {"Name": "notni", "Characters": ["0xe2", "0x88", "0x8c"]}, + {"Name": "notniva", "Characters": ["0xe2", "0x88", "0x8c"]}, + {"Name": "notnivb", "Characters": ["0xe2", "0x8b", "0xbe"]}, + {"Name": "notnivc", "Characters": ["0xe2", "0x8b", "0xbd"]}, + {"Name": "npar", "Characters": ["0xe2", "0x88", "0xa6"]}, + {"Name": "nparallel", "Characters": ["0xe2", "0x88", "0xa6"]}, + {"Name": "nparsl", "Characters": ["0xe2", "0xab", "0xbd", "0xe2", "0x83", "0xa5"]}, + {"Name": "npart", "Characters": ["0xe2", "0x88", "0x82", "0xcc", "0xb8"]}, + {"Name": "npolint", "Characters": ["0xe2", "0xa8", "0x94"]}, + {"Name": "npr", "Characters": ["0xe2", "0x8a", "0x80"]}, + {"Name": "nprcue", "Characters": ["0xe2", "0x8b", "0xa0"]}, + {"Name": "npre", "Characters": ["0xe2", "0xaa", "0xaf", "0xcc", "0xb8"]}, + {"Name": "nprec", "Characters": ["0xe2", "0x8a", "0x80"]}, + {"Name": "npreceq", "Characters": ["0xe2", "0xaa", "0xaf", "0xcc", "0xb8"]}, + {"Name": "nrArr", "Characters": ["0xe2", "0x87", "0x8f"]}, + {"Name": "nrarr", "Characters": ["0xe2", "0x86", "0x9b"]}, + {"Name": "nrarrc", "Characters": ["0xe2", "0xa4", "0xb3", "0xcc", "0xb8"]}, + {"Name": "nrarrw", "Characters": ["0xe2", "0x86", "0x9d", "0xcc", "0xb8"]}, + {"Name": "nrightarrow", "Characters": ["0xe2", "0x86", "0x9b"]}, + {"Name": "nrtri", "Characters": ["0xe2", "0x8b", "0xab"]}, + {"Name": "nrtrie", "Characters": ["0xe2", "0x8b", "0xad"]}, + {"Name": "nsc", "Characters": ["0xe2", "0x8a", "0x81"]}, + {"Name": "nsccue", "Characters": ["0xe2", "0x8b", "0xa1"]}, + {"Name": "nsce", "Characters": ["0xe2", "0xaa", "0xb0", "0xcc", "0xb8"]}, + {"Name": "nscr", "Characters": ["0xf0", "0x9d", "0x93", "0x83"]}, + {"Name": "nshortmid", "Characters": ["0xe2", "0x88", "0xa4"]}, + {"Name": "nshortparallel", "Characters": ["0xe2", "0x88", "0xa6"]}, + {"Name": "nsim", "Characters": ["0xe2", "0x89", "0x81"]}, + {"Name": "nsime", "Characters": ["0xe2", "0x89", "0x84"]}, + {"Name": "nsimeq", "Characters": ["0xe2", "0x89", "0x84"]}, + {"Name": "nsmid", "Characters": ["0xe2", "0x88", "0xa4"]}, + {"Name": "nspar", "Characters": ["0xe2", "0x88", "0xa6"]}, + {"Name": "nsqsube", "Characters": ["0xe2", "0x8b", "0xa2"]}, + {"Name": "nsqsupe", "Characters": ["0xe2", "0x8b", "0xa3"]}, + {"Name": "nsub", "Characters": ["0xe2", "0x8a", "0x84"]}, + {"Name": "nsubE", "Characters": ["0xe2", "0xab", "0x85", "0xcc", "0xb8"]}, + {"Name": "nsube", "Characters": ["0xe2", "0x8a", "0x88"]}, + {"Name": "nsubset", "Characters": ["0xe2", "0x8a", "0x82", "0xe2", "0x83", "0x92"]}, + {"Name": "nsubseteq", "Characters": ["0xe2", "0x8a", "0x88"]}, + {"Name": "nsubseteqq", "Characters": ["0xe2", "0xab", "0x85", "0xcc", "0xb8"]}, + {"Name": "nsucc", "Characters": ["0xe2", "0x8a", "0x81"]}, + {"Name": "nsucceq", "Characters": ["0xe2", "0xaa", "0xb0", "0xcc", "0xb8"]}, + {"Name": "nsup", "Characters": ["0xe2", "0x8a", "0x85"]}, + {"Name": "nsupE", "Characters": ["0xe2", "0xab", "0x86", "0xcc", "0xb8"]}, + {"Name": "nsupe", "Characters": ["0xe2", "0x8a", "0x89"]}, + {"Name": "nsupset", "Characters": ["0xe2", "0x8a", "0x83", "0xe2", "0x83", "0x92"]}, + {"Name": "nsupseteq", "Characters": ["0xe2", "0x8a", "0x89"]}, + {"Name": "nsupseteqq", "Characters": ["0xe2", "0xab", "0x86", "0xcc", "0xb8"]}, + {"Name": "ntgl", "Characters": ["0xe2", "0x89", "0xb9"]}, + {"Name": "ntilde", "Characters": ["0xc3", "0xb1"]}, + {"Name": "ntlg", "Characters": ["0xe2", "0x89", "0xb8"]}, + {"Name": "ntriangleleft", "Characters": ["0xe2", "0x8b", "0xaa"]}, + {"Name": "ntrianglelefteq", "Characters": ["0xe2", "0x8b", "0xac"]}, + {"Name": "ntriangleright", "Characters": ["0xe2", "0x8b", "0xab"]}, + {"Name": "ntrianglerighteq", "Characters": ["0xe2", "0x8b", "0xad"]}, + {"Name": "nu", "Characters": ["0xce", "0xbd"]}, + {"Name": "num", "Characters": ["0x23"]}, + {"Name": "numero", "Characters": ["0xe2", "0x84", "0x96"]}, + {"Name": "numsp", "Characters": ["0xe2", "0x80", "0x87"]}, + {"Name": "nvDash", "Characters": ["0xe2", "0x8a", "0xad"]}, + {"Name": "nvHarr", "Characters": ["0xe2", "0xa4", "0x84"]}, + {"Name": "nvap", "Characters": ["0xe2", "0x89", "0x8d", "0xe2", "0x83", "0x92"]}, + {"Name": "nvdash", "Characters": ["0xe2", "0x8a", "0xac"]}, + {"Name": "nvge", "Characters": ["0xe2", "0x89", "0xa5", "0xe2", "0x83", "0x92"]}, + {"Name": "nvgt", "Characters": ["0x3e", "0xe2", "0x83", "0x92"]}, + {"Name": "nvinfin", "Characters": ["0xe2", "0xa7", "0x9e"]}, + {"Name": "nvlArr", "Characters": ["0xe2", "0xa4", "0x82"]}, + {"Name": "nvle", "Characters": ["0xe2", "0x89", "0xa4", "0xe2", "0x83", "0x92"]}, + {"Name": "nvlt", "Characters": ["0x3c", "0xe2", "0x83", "0x92"]}, + {"Name": "nvltrie", "Characters": ["0xe2", "0x8a", "0xb4", "0xe2", "0x83", "0x92"]}, + {"Name": "nvrArr", "Characters": ["0xe2", "0xa4", "0x83"]}, + {"Name": "nvrtrie", "Characters": ["0xe2", "0x8a", "0xb5", "0xe2", "0x83", "0x92"]}, + {"Name": "nvsim", "Characters": ["0xe2", "0x88", "0xbc", "0xe2", "0x83", "0x92"]}, + {"Name": "nwArr", "Characters": ["0xe2", "0x87", "0x96"]}, + {"Name": "nwarhk", "Characters": ["0xe2", "0xa4", "0xa3"]}, + {"Name": "nwarr", "Characters": ["0xe2", "0x86", "0x96"]}, + {"Name": "nwarrow", "Characters": ["0xe2", "0x86", "0x96"]}, + {"Name": "nwnear", "Characters": ["0xe2", "0xa4", "0xa7"]}, + {"Name": "oS", "Characters": ["0xe2", "0x93", "0x88"]}, + {"Name": "oacute", "Characters": ["0xc3", "0xb3"]}, + {"Name": "oast", "Characters": ["0xe2", "0x8a", "0x9b"]}, + {"Name": "ocir", "Characters": ["0xe2", "0x8a", "0x9a"]}, + {"Name": "ocirc", "Characters": ["0xc3", "0xb4"]}, + {"Name": "ocy", "Characters": ["0xd0", "0xbe"]}, + {"Name": "odash", "Characters": ["0xe2", "0x8a", "0x9d"]}, + {"Name": "odblac", "Characters": ["0xc5", "0x91"]}, + {"Name": "odiv", "Characters": ["0xe2", "0xa8", "0xb8"]}, + {"Name": "odot", "Characters": ["0xe2", "0x8a", "0x99"]}, + {"Name": "odsold", "Characters": ["0xe2", "0xa6", "0xbc"]}, + {"Name": "oelig", "Characters": ["0xc5", "0x93"]}, + {"Name": "ofcir", "Characters": ["0xe2", "0xa6", "0xbf"]}, + {"Name": "ofr", "Characters": ["0xf0", "0x9d", "0x94", "0xac"]}, + {"Name": "ogon", "Characters": ["0xcb", "0x9b"]}, + {"Name": "ograve", "Characters": ["0xc3", "0xb2"]}, + {"Name": "ogt", "Characters": ["0xe2", "0xa7", "0x81"]}, + {"Name": "ohbar", "Characters": ["0xe2", "0xa6", "0xb5"]}, + {"Name": "ohm", "Characters": ["0xce", "0xa9"]}, + {"Name": "oint", "Characters": ["0xe2", "0x88", "0xae"]}, + {"Name": "olarr", "Characters": ["0xe2", "0x86", "0xba"]}, + {"Name": "olcir", "Characters": ["0xe2", "0xa6", "0xbe"]}, + {"Name": "olcross", "Characters": ["0xe2", "0xa6", "0xbb"]}, + {"Name": "oline", "Characters": ["0xe2", "0x80", "0xbe"]}, + {"Name": "olt", "Characters": ["0xe2", "0xa7", "0x80"]}, + {"Name": "omacr", "Characters": ["0xc5", "0x8d"]}, + {"Name": "omega", "Characters": ["0xcf", "0x89"]}, + {"Name": "omicron", "Characters": ["0xce", "0xbf"]}, + {"Name": "omid", "Characters": ["0xe2", "0xa6", "0xb6"]}, + {"Name": "ominus", "Characters": ["0xe2", "0x8a", "0x96"]}, + {"Name": "oopf", "Characters": ["0xf0", "0x9d", "0x95", "0xa0"]}, + {"Name": "opar", "Characters": ["0xe2", "0xa6", "0xb7"]}, + {"Name": "operp", "Characters": ["0xe2", "0xa6", "0xb9"]}, + {"Name": "oplus", "Characters": ["0xe2", "0x8a", "0x95"]}, + {"Name": "or", "Characters": ["0xe2", "0x88", "0xa8"]}, + {"Name": "orarr", "Characters": ["0xe2", "0x86", "0xbb"]}, + {"Name": "ord", "Characters": ["0xe2", "0xa9", "0x9d"]}, + {"Name": "order", "Characters": ["0xe2", "0x84", "0xb4"]}, + {"Name": "orderof", "Characters": ["0xe2", "0x84", "0xb4"]}, + {"Name": "ordf", "Characters": ["0xc2", "0xaa"]}, + {"Name": "ordm", "Characters": ["0xc2", "0xba"]}, + {"Name": "origof", "Characters": ["0xe2", "0x8a", "0xb6"]}, + {"Name": "oror", "Characters": ["0xe2", "0xa9", "0x96"]}, + {"Name": "orslope", "Characters": ["0xe2", "0xa9", "0x97"]}, + {"Name": "orv", "Characters": ["0xe2", "0xa9", "0x9b"]}, + {"Name": "oscr", "Characters": ["0xe2", "0x84", "0xb4"]}, + {"Name": "oslash", "Characters": ["0xc3", "0xb8"]}, + {"Name": "osol", "Characters": ["0xe2", "0x8a", "0x98"]}, + {"Name": "otilde", "Characters": ["0xc3", "0xb5"]}, + {"Name": "otimes", "Characters": ["0xe2", "0x8a", "0x97"]}, + {"Name": "otimesas", "Characters": ["0xe2", "0xa8", "0xb6"]}, + {"Name": "ouml", "Characters": ["0xc3", "0xb6"]}, + {"Name": "ovbar", "Characters": ["0xe2", "0x8c", "0xbd"]}, + {"Name": "par", "Characters": ["0xe2", "0x88", "0xa5"]}, + {"Name": "para", "Characters": ["0xc2", "0xb6"]}, + {"Name": "parallel", "Characters": ["0xe2", "0x88", "0xa5"]}, + {"Name": "parsim", "Characters": ["0xe2", "0xab", "0xb3"]}, + {"Name": "parsl", "Characters": ["0xe2", "0xab", "0xbd"]}, + {"Name": "part", "Characters": ["0xe2", "0x88", "0x82"]}, + {"Name": "pcy", "Characters": ["0xd0", "0xbf"]}, + {"Name": "percnt", "Characters": ["0x25"]}, + {"Name": "period", "Characters": ["0x2e"]}, + {"Name": "permil", "Characters": ["0xe2", "0x80", "0xb0"]}, + {"Name": "perp", "Characters": ["0xe2", "0x8a", "0xa5"]}, + {"Name": "pertenk", "Characters": ["0xe2", "0x80", "0xb1"]}, + {"Name": "pfr", "Characters": ["0xf0", "0x9d", "0x94", "0xad"]}, + {"Name": "phi", "Characters": ["0xcf", "0x86"]}, + {"Name": "phiv", "Characters": ["0xcf", "0x95"]}, + {"Name": "phmmat", "Characters": ["0xe2", "0x84", "0xb3"]}, + {"Name": "phone", "Characters": ["0xe2", "0x98", "0x8e"]}, + {"Name": "pi", "Characters": ["0xcf", "0x80"]}, + {"Name": "pitchfork", "Characters": ["0xe2", "0x8b", "0x94"]}, + {"Name": "piv", "Characters": ["0xcf", "0x96"]}, + {"Name": "planck", "Characters": ["0xe2", "0x84", "0x8f"]}, + {"Name": "planckh", "Characters": ["0xe2", "0x84", "0x8e"]}, + {"Name": "plankv", "Characters": ["0xe2", "0x84", "0x8f"]}, + {"Name": "plus", "Characters": ["0x2b"]}, + {"Name": "plusacir", "Characters": ["0xe2", "0xa8", "0xa3"]}, + {"Name": "plusb", "Characters": ["0xe2", "0x8a", "0x9e"]}, + {"Name": "pluscir", "Characters": ["0xe2", "0xa8", "0xa2"]}, + {"Name": "plusdo", "Characters": ["0xe2", "0x88", "0x94"]}, + {"Name": "plusdu", "Characters": ["0xe2", "0xa8", "0xa5"]}, + {"Name": "pluse", "Characters": ["0xe2", "0xa9", "0xb2"]}, + {"Name": "plusmn", "Characters": ["0xc2", "0xb1"]}, + {"Name": "plussim", "Characters": ["0xe2", "0xa8", "0xa6"]}, + {"Name": "plustwo", "Characters": ["0xe2", "0xa8", "0xa7"]}, + {"Name": "pm", "Characters": ["0xc2", "0xb1"]}, + {"Name": "pointint", "Characters": ["0xe2", "0xa8", "0x95"]}, + {"Name": "popf", "Characters": ["0xf0", "0x9d", "0x95", "0xa1"]}, + {"Name": "pound", "Characters": ["0xc2", "0xa3"]}, + {"Name": "pr", "Characters": ["0xe2", "0x89", "0xba"]}, + {"Name": "prE", "Characters": ["0xe2", "0xaa", "0xb3"]}, + {"Name": "prap", "Characters": ["0xe2", "0xaa", "0xb7"]}, + {"Name": "prcue", "Characters": ["0xe2", "0x89", "0xbc"]}, + {"Name": "pre", "Characters": ["0xe2", "0xaa", "0xaf"]}, + {"Name": "prec", "Characters": ["0xe2", "0x89", "0xba"]}, + {"Name": "precapprox", "Characters": ["0xe2", "0xaa", "0xb7"]}, + {"Name": "preccurlyeq", "Characters": ["0xe2", "0x89", "0xbc"]}, + {"Name": "preceq", "Characters": ["0xe2", "0xaa", "0xaf"]}, + {"Name": "precnapprox", "Characters": ["0xe2", "0xaa", "0xb9"]}, + {"Name": "precneqq", "Characters": ["0xe2", "0xaa", "0xb5"]}, + {"Name": "precnsim", "Characters": ["0xe2", "0x8b", "0xa8"]}, + {"Name": "precsim", "Characters": ["0xe2", "0x89", "0xbe"]}, + {"Name": "prime", "Characters": ["0xe2", "0x80", "0xb2"]}, + {"Name": "primes", "Characters": ["0xe2", "0x84", "0x99"]}, + {"Name": "prnE", "Characters": ["0xe2", "0xaa", "0xb5"]}, + {"Name": "prnap", "Characters": ["0xe2", "0xaa", "0xb9"]}, + {"Name": "prnsim", "Characters": ["0xe2", "0x8b", "0xa8"]}, + {"Name": "prod", "Characters": ["0xe2", "0x88", "0x8f"]}, + {"Name": "profalar", "Characters": ["0xe2", "0x8c", "0xae"]}, + {"Name": "profline", "Characters": ["0xe2", "0x8c", "0x92"]}, + {"Name": "profsurf", "Characters": ["0xe2", "0x8c", "0x93"]}, + {"Name": "prop", "Characters": ["0xe2", "0x88", "0x9d"]}, + {"Name": "propto", "Characters": ["0xe2", "0x88", "0x9d"]}, + {"Name": "prsim", "Characters": ["0xe2", "0x89", "0xbe"]}, + {"Name": "prurel", "Characters": ["0xe2", "0x8a", "0xb0"]}, + {"Name": "pscr", "Characters": ["0xf0", "0x9d", "0x93", "0x85"]}, + {"Name": "psi", "Characters": ["0xcf", "0x88"]}, + {"Name": "puncsp", "Characters": ["0xe2", "0x80", "0x88"]}, + {"Name": "qfr", "Characters": ["0xf0", "0x9d", "0x94", "0xae"]}, + {"Name": "qint", "Characters": ["0xe2", "0xa8", "0x8c"]}, + {"Name": "qopf", "Characters": ["0xf0", "0x9d", "0x95", "0xa2"]}, + {"Name": "qprime", "Characters": ["0xe2", "0x81", "0x97"]}, + {"Name": "qscr", "Characters": ["0xf0", "0x9d", "0x93", "0x86"]}, + {"Name": "quaternions", "Characters": ["0xe2", "0x84", "0x8d"]}, + {"Name": "quatint", "Characters": ["0xe2", "0xa8", "0x96"]}, + {"Name": "quest", "Characters": ["0x3f"]}, + {"Name": "questeq", "Characters": ["0xe2", "0x89", "0x9f"]}, + {"Name": "quot", "Characters": ["0x22"]}, + {"Name": "rAarr", "Characters": ["0xe2", "0x87", "0x9b"]}, + {"Name": "rArr", "Characters": ["0xe2", "0x87", "0x92"]}, + {"Name": "rAtail", "Characters": ["0xe2", "0xa4", "0x9c"]}, + {"Name": "rBarr", "Characters": ["0xe2", "0xa4", "0x8f"]}, + {"Name": "rHar", "Characters": ["0xe2", "0xa5", "0xa4"]}, + {"Name": "race", "Characters": ["0xe2", "0x88", "0xbd", "0xcc", "0xb1"]}, + {"Name": "racute", "Characters": ["0xc5", "0x95"]}, + {"Name": "radic", "Characters": ["0xe2", "0x88", "0x9a"]}, + {"Name": "raemptyv", "Characters": ["0xe2", "0xa6", "0xb3"]}, + {"Name": "rang", "Characters": ["0xe2", "0x9f", "0xa9"]}, + {"Name": "rangd", "Characters": ["0xe2", "0xa6", "0x92"]}, + {"Name": "range", "Characters": ["0xe2", "0xa6", "0xa5"]}, + {"Name": "rangle", "Characters": ["0xe2", "0x9f", "0xa9"]}, + {"Name": "raquo", "Characters": ["0xc2", "0xbb"]}, + {"Name": "rarr", "Characters": ["0xe2", "0x86", "0x92"]}, + {"Name": "rarrap", "Characters": ["0xe2", "0xa5", "0xb5"]}, + {"Name": "rarrb", "Characters": ["0xe2", "0x87", "0xa5"]}, + {"Name": "rarrbfs", "Characters": ["0xe2", "0xa4", "0xa0"]}, + {"Name": "rarrc", "Characters": ["0xe2", "0xa4", "0xb3"]}, + {"Name": "rarrfs", "Characters": ["0xe2", "0xa4", "0x9e"]}, + {"Name": "rarrhk", "Characters": ["0xe2", "0x86", "0xaa"]}, + {"Name": "rarrlp", "Characters": ["0xe2", "0x86", "0xac"]}, + {"Name": "rarrpl", "Characters": ["0xe2", "0xa5", "0x85"]}, + {"Name": "rarrsim", "Characters": ["0xe2", "0xa5", "0xb4"]}, + {"Name": "rarrtl", "Characters": ["0xe2", "0x86", "0xa3"]}, + {"Name": "rarrw", "Characters": ["0xe2", "0x86", "0x9d"]}, + {"Name": "ratail", "Characters": ["0xe2", "0xa4", "0x9a"]}, + {"Name": "ratio", "Characters": ["0xe2", "0x88", "0xb6"]}, + {"Name": "rationals", "Characters": ["0xe2", "0x84", "0x9a"]}, + {"Name": "rbarr", "Characters": ["0xe2", "0xa4", "0x8d"]}, + {"Name": "rbbrk", "Characters": ["0xe2", "0x9d", "0xb3"]}, + {"Name": "rbrace", "Characters": ["0x7d"]}, + {"Name": "rbrack", "Characters": ["0x5d"]}, + {"Name": "rbrke", "Characters": ["0xe2", "0xa6", "0x8c"]}, + {"Name": "rbrksld", "Characters": ["0xe2", "0xa6", "0x8e"]}, + {"Name": "rbrkslu", "Characters": ["0xe2", "0xa6", "0x90"]}, + {"Name": "rcaron", "Characters": ["0xc5", "0x99"]}, + {"Name": "rcedil", "Characters": ["0xc5", "0x97"]}, + {"Name": "rceil", "Characters": ["0xe2", "0x8c", "0x89"]}, + {"Name": "rcub", "Characters": ["0x7d"]}, + {"Name": "rcy", "Characters": ["0xd1", "0x80"]}, + {"Name": "rdca", "Characters": ["0xe2", "0xa4", "0xb7"]}, + {"Name": "rdldhar", "Characters": ["0xe2", "0xa5", "0xa9"]}, + {"Name": "rdquo", "Characters": ["0xe2", "0x80", "0x9d"]}, + {"Name": "rdquor", "Characters": ["0xe2", "0x80", "0x9d"]}, + {"Name": "rdsh", "Characters": ["0xe2", "0x86", "0xb3"]}, + {"Name": "real", "Characters": ["0xe2", "0x84", "0x9c"]}, + {"Name": "realine", "Characters": ["0xe2", "0x84", "0x9b"]}, + {"Name": "realpart", "Characters": ["0xe2", "0x84", "0x9c"]}, + {"Name": "reals", "Characters": ["0xe2", "0x84", "0x9d"]}, + {"Name": "rect", "Characters": ["0xe2", "0x96", "0xad"]}, + {"Name": "reg", "Characters": ["0xc2", "0xae"]}, + {"Name": "rfisht", "Characters": ["0xe2", "0xa5", "0xbd"]}, + {"Name": "rfloor", "Characters": ["0xe2", "0x8c", "0x8b"]}, + {"Name": "rfr", "Characters": ["0xf0", "0x9d", "0x94", "0xaf"]}, + {"Name": "rhard", "Characters": ["0xe2", "0x87", "0x81"]}, + {"Name": "rharu", "Characters": ["0xe2", "0x87", "0x80"]}, + {"Name": "rharul", "Characters": ["0xe2", "0xa5", "0xac"]}, + {"Name": "rho", "Characters": ["0xcf", "0x81"]}, + {"Name": "rhov", "Characters": ["0xcf", "0xb1"]}, + {"Name": "rightarrow", "Characters": ["0xe2", "0x86", "0x92"]}, + {"Name": "rightarrowtail", "Characters": ["0xe2", "0x86", "0xa3"]}, + {"Name": "rightharpoondown", "Characters": ["0xe2", "0x87", "0x81"]}, + {"Name": "rightharpoonup", "Characters": ["0xe2", "0x87", "0x80"]}, + {"Name": "rightleftarrows", "Characters": ["0xe2", "0x87", "0x84"]}, + {"Name": "rightleftharpoons", "Characters": ["0xe2", "0x87", "0x8c"]}, + {"Name": "rightrightarrows", "Characters": ["0xe2", "0x87", "0x89"]}, + {"Name": "rightsquigarrow", "Characters": ["0xe2", "0x86", "0x9d"]}, + {"Name": "rightthreetimes", "Characters": ["0xe2", "0x8b", "0x8c"]}, + {"Name": "ring", "Characters": ["0xcb", "0x9a"]}, + {"Name": "risingdotseq", "Characters": ["0xe2", "0x89", "0x93"]}, + {"Name": "rlarr", "Characters": ["0xe2", "0x87", "0x84"]}, + {"Name": "rlhar", "Characters": ["0xe2", "0x87", "0x8c"]}, + {"Name": "rlm", "Characters": ["0xe2", "0x80", "0x8f"]}, + {"Name": "rmoust", "Characters": ["0xe2", "0x8e", "0xb1"]}, + {"Name": "rmoustache", "Characters": ["0xe2", "0x8e", "0xb1"]}, + {"Name": "rnmid", "Characters": ["0xe2", "0xab", "0xae"]}, + {"Name": "roang", "Characters": ["0xe2", "0x9f", "0xad"]}, + {"Name": "roarr", "Characters": ["0xe2", "0x87", "0xbe"]}, + {"Name": "robrk", "Characters": ["0xe2", "0x9f", "0xa7"]}, + {"Name": "ropar", "Characters": ["0xe2", "0xa6", "0x86"]}, + {"Name": "ropf", "Characters": ["0xf0", "0x9d", "0x95", "0xa3"]}, + {"Name": "roplus", "Characters": ["0xe2", "0xa8", "0xae"]}, + {"Name": "rotimes", "Characters": ["0xe2", "0xa8", "0xb5"]}, + {"Name": "rpar", "Characters": ["0x29"]}, + {"Name": "rpargt", "Characters": ["0xe2", "0xa6", "0x94"]}, + {"Name": "rppolint", "Characters": ["0xe2", "0xa8", "0x92"]}, + {"Name": "rrarr", "Characters": ["0xe2", "0x87", "0x89"]}, + {"Name": "rsaquo", "Characters": ["0xe2", "0x80", "0xba"]}, + {"Name": "rscr", "Characters": ["0xf0", "0x9d", "0x93", "0x87"]}, + {"Name": "rsh", "Characters": ["0xe2", "0x86", "0xb1"]}, + {"Name": "rsqb", "Characters": ["0x5d"]}, + {"Name": "rsquo", "Characters": ["0xe2", "0x80", "0x99"]}, + {"Name": "rsquor", "Characters": ["0xe2", "0x80", "0x99"]}, + {"Name": "rthree", "Characters": ["0xe2", "0x8b", "0x8c"]}, + {"Name": "rtimes", "Characters": ["0xe2", "0x8b", "0x8a"]}, + {"Name": "rtri", "Characters": ["0xe2", "0x96", "0xb9"]}, + {"Name": "rtrie", "Characters": ["0xe2", "0x8a", "0xb5"]}, + {"Name": "rtrif", "Characters": ["0xe2", "0x96", "0xb8"]}, + {"Name": "rtriltri", "Characters": ["0xe2", "0xa7", "0x8e"]}, + {"Name": "ruluhar", "Characters": ["0xe2", "0xa5", "0xa8"]}, + {"Name": "rx", "Characters": ["0xe2", "0x84", "0x9e"]}, + {"Name": "sacute", "Characters": ["0xc5", "0x9b"]}, + {"Name": "sbquo", "Characters": ["0xe2", "0x80", "0x9a"]}, + {"Name": "sc", "Characters": ["0xe2", "0x89", "0xbb"]}, + {"Name": "scE", "Characters": ["0xe2", "0xaa", "0xb4"]}, + {"Name": "scap", "Characters": ["0xe2", "0xaa", "0xb8"]}, + {"Name": "scaron", "Characters": ["0xc5", "0xa1"]}, + {"Name": "sccue", "Characters": ["0xe2", "0x89", "0xbd"]}, + {"Name": "sce", "Characters": ["0xe2", "0xaa", "0xb0"]}, + {"Name": "scedil", "Characters": ["0xc5", "0x9f"]}, + {"Name": "scirc", "Characters": ["0xc5", "0x9d"]}, + {"Name": "scnE", "Characters": ["0xe2", "0xaa", "0xb6"]}, + {"Name": "scnap", "Characters": ["0xe2", "0xaa", "0xba"]}, + {"Name": "scnsim", "Characters": ["0xe2", "0x8b", "0xa9"]}, + {"Name": "scpolint", "Characters": ["0xe2", "0xa8", "0x93"]}, + {"Name": "scsim", "Characters": ["0xe2", "0x89", "0xbf"]}, + {"Name": "scy", "Characters": ["0xd1", "0x81"]}, + {"Name": "sdot", "Characters": ["0xe2", "0x8b", "0x85"]}, + {"Name": "sdotb", "Characters": ["0xe2", "0x8a", "0xa1"]}, + {"Name": "sdote", "Characters": ["0xe2", "0xa9", "0xa6"]}, + {"Name": "seArr", "Characters": ["0xe2", "0x87", "0x98"]}, + {"Name": "searhk", "Characters": ["0xe2", "0xa4", "0xa5"]}, + {"Name": "searr", "Characters": ["0xe2", "0x86", "0x98"]}, + {"Name": "searrow", "Characters": ["0xe2", "0x86", "0x98"]}, + {"Name": "sect", "Characters": ["0xc2", "0xa7"]}, + {"Name": "semi", "Characters": ["0x3b"]}, + {"Name": "seswar", "Characters": ["0xe2", "0xa4", "0xa9"]}, + {"Name": "setminus", "Characters": ["0xe2", "0x88", "0x96"]}, + {"Name": "setmn", "Characters": ["0xe2", "0x88", "0x96"]}, + {"Name": "sext", "Characters": ["0xe2", "0x9c", "0xb6"]}, + {"Name": "sfr", "Characters": ["0xf0", "0x9d", "0x94", "0xb0"]}, + {"Name": "sfrown", "Characters": ["0xe2", "0x8c", "0xa2"]}, + {"Name": "sharp", "Characters": ["0xe2", "0x99", "0xaf"]}, + {"Name": "shchcy", "Characters": ["0xd1", "0x89"]}, + {"Name": "shcy", "Characters": ["0xd1", "0x88"]}, + {"Name": "shortmid", "Characters": ["0xe2", "0x88", "0xa3"]}, + {"Name": "shortparallel", "Characters": ["0xe2", "0x88", "0xa5"]}, + {"Name": "shy", "Characters": ["0xc2", "0xad"]}, + {"Name": "sigma", "Characters": ["0xcf", "0x83"]}, + {"Name": "sigmaf", "Characters": ["0xcf", "0x82"]}, + {"Name": "sigmav", "Characters": ["0xcf", "0x82"]}, + {"Name": "sim", "Characters": ["0xe2", "0x88", "0xbc"]}, + {"Name": "simdot", "Characters": ["0xe2", "0xa9", "0xaa"]}, + {"Name": "sime", "Characters": ["0xe2", "0x89", "0x83"]}, + {"Name": "simeq", "Characters": ["0xe2", "0x89", "0x83"]}, + {"Name": "simg", "Characters": ["0xe2", "0xaa", "0x9e"]}, + {"Name": "simgE", "Characters": ["0xe2", "0xaa", "0xa0"]}, + {"Name": "siml", "Characters": ["0xe2", "0xaa", "0x9d"]}, + {"Name": "simlE", "Characters": ["0xe2", "0xaa", "0x9f"]}, + {"Name": "simne", "Characters": ["0xe2", "0x89", "0x86"]}, + {"Name": "simplus", "Characters": ["0xe2", "0xa8", "0xa4"]}, + {"Name": "simrarr", "Characters": ["0xe2", "0xa5", "0xb2"]}, + {"Name": "slarr", "Characters": ["0xe2", "0x86", "0x90"]}, + {"Name": "smallsetminus", "Characters": ["0xe2", "0x88", "0x96"]}, + {"Name": "smashp", "Characters": ["0xe2", "0xa8", "0xb3"]}, + {"Name": "smeparsl", "Characters": ["0xe2", "0xa7", "0xa4"]}, + {"Name": "smid", "Characters": ["0xe2", "0x88", "0xa3"]}, + {"Name": "smile", "Characters": ["0xe2", "0x8c", "0xa3"]}, + {"Name": "smt", "Characters": ["0xe2", "0xaa", "0xaa"]}, + {"Name": "smte", "Characters": ["0xe2", "0xaa", "0xac"]}, + {"Name": "smtes", "Characters": ["0xe2", "0xaa", "0xac", "0xef", "0xb8", "0x80"]}, + {"Name": "softcy", "Characters": ["0xd1", "0x8c"]}, + {"Name": "sol", "Characters": ["0x2f"]}, + {"Name": "solb", "Characters": ["0xe2", "0xa7", "0x84"]}, + {"Name": "solbar", "Characters": ["0xe2", "0x8c", "0xbf"]}, + {"Name": "sopf", "Characters": ["0xf0", "0x9d", "0x95", "0xa4"]}, + {"Name": "spades", "Characters": ["0xe2", "0x99", "0xa0"]}, + {"Name": "spadesuit", "Characters": ["0xe2", "0x99", "0xa0"]}, + {"Name": "spar", "Characters": ["0xe2", "0x88", "0xa5"]}, + {"Name": "sqcap", "Characters": ["0xe2", "0x8a", "0x93"]}, + {"Name": "sqcaps", "Characters": ["0xe2", "0x8a", "0x93", "0xef", "0xb8", "0x80"]}, + {"Name": "sqcup", "Characters": ["0xe2", "0x8a", "0x94"]}, + {"Name": "sqcups", "Characters": ["0xe2", "0x8a", "0x94", "0xef", "0xb8", "0x80"]}, + {"Name": "sqsub", "Characters": ["0xe2", "0x8a", "0x8f"]}, + {"Name": "sqsube", "Characters": ["0xe2", "0x8a", "0x91"]}, + {"Name": "sqsubset", "Characters": ["0xe2", "0x8a", "0x8f"]}, + {"Name": "sqsubseteq", "Characters": ["0xe2", "0x8a", "0x91"]}, + {"Name": "sqsup", "Characters": ["0xe2", "0x8a", "0x90"]}, + {"Name": "sqsupe", "Characters": ["0xe2", "0x8a", "0x92"]}, + {"Name": "sqsupset", "Characters": ["0xe2", "0x8a", "0x90"]}, + {"Name": "sqsupseteq", "Characters": ["0xe2", "0x8a", "0x92"]}, + {"Name": "squ", "Characters": ["0xe2", "0x96", "0xa1"]}, + {"Name": "square", "Characters": ["0xe2", "0x96", "0xa1"]}, + {"Name": "squarf", "Characters": ["0xe2", "0x96", "0xaa"]}, + {"Name": "squf", "Characters": ["0xe2", "0x96", "0xaa"]}, + {"Name": "srarr", "Characters": ["0xe2", "0x86", "0x92"]}, + {"Name": "sscr", "Characters": ["0xf0", "0x9d", "0x93", "0x88"]}, + {"Name": "ssetmn", "Characters": ["0xe2", "0x88", "0x96"]}, + {"Name": "ssmile", "Characters": ["0xe2", "0x8c", "0xa3"]}, + {"Name": "sstarf", "Characters": ["0xe2", "0x8b", "0x86"]}, + {"Name": "star", "Characters": ["0xe2", "0x98", "0x86"]}, + {"Name": "starf", "Characters": ["0xe2", "0x98", "0x85"]}, + {"Name": "straightepsilon", "Characters": ["0xcf", "0xb5"]}, + {"Name": "straightphi", "Characters": ["0xcf", "0x95"]}, + {"Name": "strns", "Characters": ["0xc2", "0xaf"]}, + {"Name": "sub", "Characters": ["0xe2", "0x8a", "0x82"]}, + {"Name": "subE", "Characters": ["0xe2", "0xab", "0x85"]}, + {"Name": "subdot", "Characters": ["0xe2", "0xaa", "0xbd"]}, + {"Name": "sube", "Characters": ["0xe2", "0x8a", "0x86"]}, + {"Name": "subedot", "Characters": ["0xe2", "0xab", "0x83"]}, + {"Name": "submult", "Characters": ["0xe2", "0xab", "0x81"]}, + {"Name": "subnE", "Characters": ["0xe2", "0xab", "0x8b"]}, + {"Name": "subne", "Characters": ["0xe2", "0x8a", "0x8a"]}, + {"Name": "subplus", "Characters": ["0xe2", "0xaa", "0xbf"]}, + {"Name": "subrarr", "Characters": ["0xe2", "0xa5", "0xb9"]}, + {"Name": "subset", "Characters": ["0xe2", "0x8a", "0x82"]}, + {"Name": "subseteq", "Characters": ["0xe2", "0x8a", "0x86"]}, + {"Name": "subseteqq", "Characters": ["0xe2", "0xab", "0x85"]}, + {"Name": "subsetneq", "Characters": ["0xe2", "0x8a", "0x8a"]}, + {"Name": "subsetneqq", "Characters": ["0xe2", "0xab", "0x8b"]}, + {"Name": "subsim", "Characters": ["0xe2", "0xab", "0x87"]}, + {"Name": "subsub", "Characters": ["0xe2", "0xab", "0x95"]}, + {"Name": "subsup", "Characters": ["0xe2", "0xab", "0x93"]}, + {"Name": "succ", "Characters": ["0xe2", "0x89", "0xbb"]}, + {"Name": "succapprox", "Characters": ["0xe2", "0xaa", "0xb8"]}, + {"Name": "succcurlyeq", "Characters": ["0xe2", "0x89", "0xbd"]}, + {"Name": "succeq", "Characters": ["0xe2", "0xaa", "0xb0"]}, + {"Name": "succnapprox", "Characters": ["0xe2", "0xaa", "0xba"]}, + {"Name": "succneqq", "Characters": ["0xe2", "0xaa", "0xb6"]}, + {"Name": "succnsim", "Characters": ["0xe2", "0x8b", "0xa9"]}, + {"Name": "succsim", "Characters": ["0xe2", "0x89", "0xbf"]}, + {"Name": "sum", "Characters": ["0xe2", "0x88", "0x91"]}, + {"Name": "sung", "Characters": ["0xe2", "0x99", "0xaa"]}, + {"Name": "sup", "Characters": ["0xe2", "0x8a", "0x83"]}, + {"Name": "sup1", "Characters": ["0xc2", "0xb9"]}, + {"Name": "sup2", "Characters": ["0xc2", "0xb2"]}, + {"Name": "sup3", "Characters": ["0xc2", "0xb3"]}, + {"Name": "supE", "Characters": ["0xe2", "0xab", "0x86"]}, + {"Name": "supdot", "Characters": ["0xe2", "0xaa", "0xbe"]}, + {"Name": "supdsub", "Characters": ["0xe2", "0xab", "0x98"]}, + {"Name": "supe", "Characters": ["0xe2", "0x8a", "0x87"]}, + {"Name": "supedot", "Characters": ["0xe2", "0xab", "0x84"]}, + {"Name": "suphsol", "Characters": ["0xe2", "0x9f", "0x89"]}, + {"Name": "suphsub", "Characters": ["0xe2", "0xab", "0x97"]}, + {"Name": "suplarr", "Characters": ["0xe2", "0xa5", "0xbb"]}, + {"Name": "supmult", "Characters": ["0xe2", "0xab", "0x82"]}, + {"Name": "supnE", "Characters": ["0xe2", "0xab", "0x8c"]}, + {"Name": "supne", "Characters": ["0xe2", "0x8a", "0x8b"]}, + {"Name": "supplus", "Characters": ["0xe2", "0xab", "0x80"]}, + {"Name": "supset", "Characters": ["0xe2", "0x8a", "0x83"]}, + {"Name": "supseteq", "Characters": ["0xe2", "0x8a", "0x87"]}, + {"Name": "supseteqq", "Characters": ["0xe2", "0xab", "0x86"]}, + {"Name": "supsetneq", "Characters": ["0xe2", "0x8a", "0x8b"]}, + {"Name": "supsetneqq", "Characters": ["0xe2", "0xab", "0x8c"]}, + {"Name": "supsim", "Characters": ["0xe2", "0xab", "0x88"]}, + {"Name": "supsub", "Characters": ["0xe2", "0xab", "0x94"]}, + {"Name": "supsup", "Characters": ["0xe2", "0xab", "0x96"]}, + {"Name": "swArr", "Characters": ["0xe2", "0x87", "0x99"]}, + {"Name": "swarhk", "Characters": ["0xe2", "0xa4", "0xa6"]}, + {"Name": "swarr", "Characters": ["0xe2", "0x86", "0x99"]}, + {"Name": "swarrow", "Characters": ["0xe2", "0x86", "0x99"]}, + {"Name": "swnwar", "Characters": ["0xe2", "0xa4", "0xaa"]}, + {"Name": "szlig", "Characters": ["0xc3", "0x9f"]}, + {"Name": "target", "Characters": ["0xe2", "0x8c", "0x96"]}, + {"Name": "tau", "Characters": ["0xcf", "0x84"]}, + {"Name": "tbrk", "Characters": ["0xe2", "0x8e", "0xb4"]}, + {"Name": "tcaron", "Characters": ["0xc5", "0xa5"]}, + {"Name": "tcedil", "Characters": ["0xc5", "0xa3"]}, + {"Name": "tcy", "Characters": ["0xd1", "0x82"]}, + {"Name": "tdot", "Characters": ["0xe2", "0x83", "0x9b"]}, + {"Name": "telrec", "Characters": ["0xe2", "0x8c", "0x95"]}, + {"Name": "tfr", "Characters": ["0xf0", "0x9d", "0x94", "0xb1"]}, + {"Name": "there4", "Characters": ["0xe2", "0x88", "0xb4"]}, + {"Name": "therefore", "Characters": ["0xe2", "0x88", "0xb4"]}, + {"Name": "theta", "Characters": ["0xce", "0xb8"]}, + {"Name": "thetasym", "Characters": ["0xcf", "0x91"]}, + {"Name": "thetav", "Characters": ["0xcf", "0x91"]}, + {"Name": "thickapprox", "Characters": ["0xe2", "0x89", "0x88"]}, + {"Name": "thicksim", "Characters": ["0xe2", "0x88", "0xbc"]}, + {"Name": "thinsp", "Characters": ["0xe2", "0x80", "0x89"]}, + {"Name": "thkap", "Characters": ["0xe2", "0x89", "0x88"]}, + {"Name": "thksim", "Characters": ["0xe2", "0x88", "0xbc"]}, + {"Name": "thorn", "Characters": ["0xc3", "0xbe"]}, + {"Name": "tilde", "Characters": ["0xcb", "0x9c"]}, + {"Name": "times", "Characters": ["0xc3", "0x97"]}, + {"Name": "timesb", "Characters": ["0xe2", "0x8a", "0xa0"]}, + {"Name": "timesbar", "Characters": ["0xe2", "0xa8", "0xb1"]}, + {"Name": "timesd", "Characters": ["0xe2", "0xa8", "0xb0"]}, + {"Name": "tint", "Characters": ["0xe2", "0x88", "0xad"]}, + {"Name": "toea", "Characters": ["0xe2", "0xa4", "0xa8"]}, + {"Name": "top", "Characters": ["0xe2", "0x8a", "0xa4"]}, + {"Name": "topbot", "Characters": ["0xe2", "0x8c", "0xb6"]}, + {"Name": "topcir", "Characters": ["0xe2", "0xab", "0xb1"]}, + {"Name": "topf", "Characters": ["0xf0", "0x9d", "0x95", "0xa5"]}, + {"Name": "topfork", "Characters": ["0xe2", "0xab", "0x9a"]}, + {"Name": "tosa", "Characters": ["0xe2", "0xa4", "0xa9"]}, + {"Name": "tprime", "Characters": ["0xe2", "0x80", "0xb4"]}, + {"Name": "trade", "Characters": ["0xe2", "0x84", "0xa2"]}, + {"Name": "triangle", "Characters": ["0xe2", "0x96", "0xb5"]}, + {"Name": "triangledown", "Characters": ["0xe2", "0x96", "0xbf"]}, + {"Name": "triangleleft", "Characters": ["0xe2", "0x97", "0x83"]}, + {"Name": "trianglelefteq", "Characters": ["0xe2", "0x8a", "0xb4"]}, + {"Name": "triangleq", "Characters": ["0xe2", "0x89", "0x9c"]}, + {"Name": "triangleright", "Characters": ["0xe2", "0x96", "0xb9"]}, + {"Name": "trianglerighteq", "Characters": ["0xe2", "0x8a", "0xb5"]}, + {"Name": "tridot", "Characters": ["0xe2", "0x97", "0xac"]}, + {"Name": "trie", "Characters": ["0xe2", "0x89", "0x9c"]}, + {"Name": "triminus", "Characters": ["0xe2", "0xa8", "0xba"]}, + {"Name": "triplus", "Characters": ["0xe2", "0xa8", "0xb9"]}, + {"Name": "trisb", "Characters": ["0xe2", "0xa7", "0x8d"]}, + {"Name": "tritime", "Characters": ["0xe2", "0xa8", "0xbb"]}, + {"Name": "trpezium", "Characters": ["0xe2", "0x8f", "0xa2"]}, + {"Name": "tscr", "Characters": ["0xf0", "0x9d", "0x93", "0x89"]}, + {"Name": "tscy", "Characters": ["0xd1", "0x86"]}, + {"Name": "tshcy", "Characters": ["0xd1", "0x9b"]}, + {"Name": "tstrok", "Characters": ["0xc5", "0xa7"]}, + {"Name": "twixt", "Characters": ["0xe2", "0x89", "0xac"]}, + {"Name": "twoheadleftarrow", "Characters": ["0xe2", "0x86", "0x9e"]}, + {"Name": "twoheadrightarrow", "Characters": ["0xe2", "0x86", "0xa0"]}, + {"Name": "uArr", "Characters": ["0xe2", "0x87", "0x91"]}, + {"Name": "uHar", "Characters": ["0xe2", "0xa5", "0xa3"]}, + {"Name": "uacute", "Characters": ["0xc3", "0xba"]}, + {"Name": "uarr", "Characters": ["0xe2", "0x86", "0x91"]}, + {"Name": "ubrcy", "Characters": ["0xd1", "0x9e"]}, + {"Name": "ubreve", "Characters": ["0xc5", "0xad"]}, + {"Name": "ucirc", "Characters": ["0xc3", "0xbb"]}, + {"Name": "ucy", "Characters": ["0xd1", "0x83"]}, + {"Name": "udarr", "Characters": ["0xe2", "0x87", "0x85"]}, + {"Name": "udblac", "Characters": ["0xc5", "0xb1"]}, + {"Name": "udhar", "Characters": ["0xe2", "0xa5", "0xae"]}, + {"Name": "ufisht", "Characters": ["0xe2", "0xa5", "0xbe"]}, + {"Name": "ufr", "Characters": ["0xf0", "0x9d", "0x94", "0xb2"]}, + {"Name": "ugrave", "Characters": ["0xc3", "0xb9"]}, + {"Name": "uharl", "Characters": ["0xe2", "0x86", "0xbf"]}, + {"Name": "uharr", "Characters": ["0xe2", "0x86", "0xbe"]}, + {"Name": "uhblk", "Characters": ["0xe2", "0x96", "0x80"]}, + {"Name": "ulcorn", "Characters": ["0xe2", "0x8c", "0x9c"]}, + {"Name": "ulcorner", "Characters": ["0xe2", "0x8c", "0x9c"]}, + {"Name": "ulcrop", "Characters": ["0xe2", "0x8c", "0x8f"]}, + {"Name": "ultri", "Characters": ["0xe2", "0x97", "0xb8"]}, + {"Name": "umacr", "Characters": ["0xc5", "0xab"]}, + {"Name": "uml", "Characters": ["0xc2", "0xa8"]}, + {"Name": "uogon", "Characters": ["0xc5", "0xb3"]}, + {"Name": "uopf", "Characters": ["0xf0", "0x9d", "0x95", "0xa6"]}, + {"Name": "uparrow", "Characters": ["0xe2", "0x86", "0x91"]}, + {"Name": "updownarrow", "Characters": ["0xe2", "0x86", "0x95"]}, + {"Name": "upharpoonleft", "Characters": ["0xe2", "0x86", "0xbf"]}, + {"Name": "upharpoonright", "Characters": ["0xe2", "0x86", "0xbe"]}, + {"Name": "uplus", "Characters": ["0xe2", "0x8a", "0x8e"]}, + {"Name": "upsi", "Characters": ["0xcf", "0x85"]}, + {"Name": "upsih", "Characters": ["0xcf", "0x92"]}, + {"Name": "upsilon", "Characters": ["0xcf", "0x85"]}, + {"Name": "upuparrows", "Characters": ["0xe2", "0x87", "0x88"]}, + {"Name": "urcorn", "Characters": ["0xe2", "0x8c", "0x9d"]}, + {"Name": "urcorner", "Characters": ["0xe2", "0x8c", "0x9d"]}, + {"Name": "urcrop", "Characters": ["0xe2", "0x8c", "0x8e"]}, + {"Name": "uring", "Characters": ["0xc5", "0xaf"]}, + {"Name": "urtri", "Characters": ["0xe2", "0x97", "0xb9"]}, + {"Name": "uscr", "Characters": ["0xf0", "0x9d", "0x93", "0x8a"]}, + {"Name": "utdot", "Characters": ["0xe2", "0x8b", "0xb0"]}, + {"Name": "utilde", "Characters": ["0xc5", "0xa9"]}, + {"Name": "utri", "Characters": ["0xe2", "0x96", "0xb5"]}, + {"Name": "utrif", "Characters": ["0xe2", "0x96", "0xb4"]}, + {"Name": "uuarr", "Characters": ["0xe2", "0x87", "0x88"]}, + {"Name": "uuml", "Characters": ["0xc3", "0xbc"]}, + {"Name": "uwangle", "Characters": ["0xe2", "0xa6", "0xa7"]}, + {"Name": "vArr", "Characters": ["0xe2", "0x87", "0x95"]}, + {"Name": "vBar", "Characters": ["0xe2", "0xab", "0xa8"]}, + {"Name": "vBarv", "Characters": ["0xe2", "0xab", "0xa9"]}, + {"Name": "vDash", "Characters": ["0xe2", "0x8a", "0xa8"]}, + {"Name": "vangrt", "Characters": ["0xe2", "0xa6", "0x9c"]}, + {"Name": "varepsilon", "Characters": ["0xcf", "0xb5"]}, + {"Name": "varkappa", "Characters": ["0xcf", "0xb0"]}, + {"Name": "varnothing", "Characters": ["0xe2", "0x88", "0x85"]}, + {"Name": "varphi", "Characters": ["0xcf", "0x95"]}, + {"Name": "varpi", "Characters": ["0xcf", "0x96"]}, + {"Name": "varpropto", "Characters": ["0xe2", "0x88", "0x9d"]}, + {"Name": "varr", "Characters": ["0xe2", "0x86", "0x95"]}, + {"Name": "varrho", "Characters": ["0xcf", "0xb1"]}, + {"Name": "varsigma", "Characters": ["0xcf", "0x82"]}, + {"Name": "varsubsetneq", "Characters": ["0xe2", "0x8a", "0x8a", "0xef", "0xb8", "0x80"]}, + {"Name": "varsubsetneqq", "Characters": ["0xe2", "0xab", "0x8b", "0xef", "0xb8", "0x80"]}, + {"Name": "varsupsetneq", "Characters": ["0xe2", "0x8a", "0x8b", "0xef", "0xb8", "0x80"]}, + {"Name": "varsupsetneqq", "Characters": ["0xe2", "0xab", "0x8c", "0xef", "0xb8", "0x80"]}, + {"Name": "vartheta", "Characters": ["0xcf", "0x91"]}, + {"Name": "vartriangleleft", "Characters": ["0xe2", "0x8a", "0xb2"]}, + {"Name": "vartriangleright", "Characters": ["0xe2", "0x8a", "0xb3"]}, + {"Name": "vcy", "Characters": ["0xd0", "0xb2"]}, + {"Name": "vdash", "Characters": ["0xe2", "0x8a", "0xa2"]}, + {"Name": "vee", "Characters": ["0xe2", "0x88", "0xa8"]}, + {"Name": "veebar", "Characters": ["0xe2", "0x8a", "0xbb"]}, + {"Name": "veeeq", "Characters": ["0xe2", "0x89", "0x9a"]}, + {"Name": "vellip", "Characters": ["0xe2", "0x8b", "0xae"]}, + {"Name": "verbar", "Characters": ["0x7c"]}, + {"Name": "vert", "Characters": ["0x7c"]}, + {"Name": "vfr", "Characters": ["0xf0", "0x9d", "0x94", "0xb3"]}, + {"Name": "vltri", "Characters": ["0xe2", "0x8a", "0xb2"]}, + {"Name": "vnsub", "Characters": ["0xe2", "0x8a", "0x82", "0xe2", "0x83", "0x92"]}, + {"Name": "vnsup", "Characters": ["0xe2", "0x8a", "0x83", "0xe2", "0x83", "0x92"]}, + {"Name": "vopf", "Characters": ["0xf0", "0x9d", "0x95", "0xa7"]}, + {"Name": "vprop", "Characters": ["0xe2", "0x88", "0x9d"]}, + {"Name": "vrtri", "Characters": ["0xe2", "0x8a", "0xb3"]}, + {"Name": "vscr", "Characters": ["0xf0", "0x9d", "0x93", "0x8b"]}, + {"Name": "vsubnE", "Characters": ["0xe2", "0xab", "0x8b", "0xef", "0xb8", "0x80"]}, + {"Name": "vsubne", "Characters": ["0xe2", "0x8a", "0x8a", "0xef", "0xb8", "0x80"]}, + {"Name": "vsupnE", "Characters": ["0xe2", "0xab", "0x8c", "0xef", "0xb8", "0x80"]}, + {"Name": "vsupne", "Characters": ["0xe2", "0x8a", "0x8b", "0xef", "0xb8", "0x80"]}, + {"Name": "vzigzag", "Characters": ["0xe2", "0xa6", "0x9a"]}, + {"Name": "wcirc", "Characters": ["0xc5", "0xb5"]}, + {"Name": "wedbar", "Characters": ["0xe2", "0xa9", "0x9f"]}, + {"Name": "wedge", "Characters": ["0xe2", "0x88", "0xa7"]}, + {"Name": "wedgeq", "Characters": ["0xe2", "0x89", "0x99"]}, + {"Name": "weierp", "Characters": ["0xe2", "0x84", "0x98"]}, + {"Name": "wfr", "Characters": ["0xf0", "0x9d", "0x94", "0xb4"]}, + {"Name": "wopf", "Characters": ["0xf0", "0x9d", "0x95", "0xa8"]}, + {"Name": "wp", "Characters": ["0xe2", "0x84", "0x98"]}, + {"Name": "wr", "Characters": ["0xe2", "0x89", "0x80"]}, + {"Name": "wreath", "Characters": ["0xe2", "0x89", "0x80"]}, + {"Name": "wscr", "Characters": ["0xf0", "0x9d", "0x93", "0x8c"]}, + {"Name": "xcap", "Characters": ["0xe2", "0x8b", "0x82"]}, + {"Name": "xcirc", "Characters": ["0xe2", "0x97", "0xaf"]}, + {"Name": "xcup", "Characters": ["0xe2", "0x8b", "0x83"]}, + {"Name": "xdtri", "Characters": ["0xe2", "0x96", "0xbd"]}, + {"Name": "xfr", "Characters": ["0xf0", "0x9d", "0x94", "0xb5"]}, + {"Name": "xhArr", "Characters": ["0xe2", "0x9f", "0xba"]}, + {"Name": "xharr", "Characters": ["0xe2", "0x9f", "0xb7"]}, + {"Name": "xi", "Characters": ["0xce", "0xbe"]}, + {"Name": "xlArr", "Characters": ["0xe2", "0x9f", "0xb8"]}, + {"Name": "xlarr", "Characters": ["0xe2", "0x9f", "0xb5"]}, + {"Name": "xmap", "Characters": ["0xe2", "0x9f", "0xbc"]}, + {"Name": "xnis", "Characters": ["0xe2", "0x8b", "0xbb"]}, + {"Name": "xodot", "Characters": ["0xe2", "0xa8", "0x80"]}, + {"Name": "xopf", "Characters": ["0xf0", "0x9d", "0x95", "0xa9"]}, + {"Name": "xoplus", "Characters": ["0xe2", "0xa8", "0x81"]}, + {"Name": "xotime", "Characters": ["0xe2", "0xa8", "0x82"]}, + {"Name": "xrArr", "Characters": ["0xe2", "0x9f", "0xb9"]}, + {"Name": "xrarr", "Characters": ["0xe2", "0x9f", "0xb6"]}, + {"Name": "xscr", "Characters": ["0xf0", "0x9d", "0x93", "0x8d"]}, + {"Name": "xsqcup", "Characters": ["0xe2", "0xa8", "0x86"]}, + {"Name": "xuplus", "Characters": ["0xe2", "0xa8", "0x84"]}, + {"Name": "xutri", "Characters": ["0xe2", "0x96", "0xb3"]}, + {"Name": "xvee", "Characters": ["0xe2", "0x8b", "0x81"]}, + {"Name": "xwedge", "Characters": ["0xe2", "0x8b", "0x80"]}, + {"Name": "yacute", "Characters": ["0xc3", "0xbd"]}, + {"Name": "yacy", "Characters": ["0xd1", "0x8f"]}, + {"Name": "ycirc", "Characters": ["0xc5", "0xb7"]}, + {"Name": "ycy", "Characters": ["0xd1", "0x8b"]}, + {"Name": "yen", "Characters": ["0xc2", "0xa5"]}, + {"Name": "yfr", "Characters": ["0xf0", "0x9d", "0x94", "0xb6"]}, + {"Name": "yicy", "Characters": ["0xd1", "0x97"]}, + {"Name": "yopf", "Characters": ["0xf0", "0x9d", "0x95", "0xaa"]}, + {"Name": "yscr", "Characters": ["0xf0", "0x9d", "0x93", "0x8e"]}, + {"Name": "yucy", "Characters": ["0xd1", "0x8e"]}, + {"Name": "yuml", "Characters": ["0xc3", "0xbf"]}, + {"Name": "zacute", "Characters": ["0xc5", "0xba"]}, + {"Name": "zcaron", "Characters": ["0xc5", "0xbe"]}, + {"Name": "zcy", "Characters": ["0xd0", "0xb7"]}, + {"Name": "zdot", "Characters": ["0xc5", "0xbc"]}, + {"Name": "zeetrf", "Characters": ["0xe2", "0x84", "0xa8"]}, + {"Name": "zeta", "Characters": ["0xce", "0xb6"]}, + {"Name": "zfr", "Characters": ["0xf0", "0x9d", "0x94", "0xb7"]}, + {"Name": "zhcy", "Characters": ["0xd0", "0xb6"]}, + {"Name": "zigrarr", "Characters": ["0xe2", "0x87", "0x9d"]}, + {"Name": "zopf", "Characters": ["0xf0", "0x9d", "0x95", "0xab"]}, + {"Name": "zscr", "Characters": ["0xf0", "0x9d", "0x93", "0x8f"]}, + {"Name": "zwj", "Characters": ["0xe2", "0x80", "0x8d"]}, + {"Name": "zwnj", "Characters": ["0xe2", "0x80", "0x8c"]} + ] +} diff --git a/_tools/main.go b/_tools/main.go new file mode 100644 index 0000000..556aa00 --- /dev/null +++ b/_tools/main.go @@ -0,0 +1,45 @@ +package main + +import ( + "fmt" + "os" +) + +func main() { + + var args []string + cmd := "-h" + if len(os.Args) > 1 { + cmd = os.Args[1] + } + if len(os.Args) > 2 { + args = os.Args[2:] + } + + switch cmd { + case "oss-fuzz-corpus": + ossFuzzCorpusSubCommand(args) + case "unicode-case-folding-map": + unicodeCaseFoldingMapSubCommand(args) + case "emb-structs": + embStructsSubCommand(args) + case "-h": + fallthrough + default: + fmt.Fprintf(os.Stderr, `Usage: _tools [options] +subcommands: + oss-fuzz-corpus + unicode-case-folding-map + emb-structs +`) + os.Exit(1) + } +} + +func usage(u func(), err error) { + u() + if err != nil { + fmt.Fprint(os.Stderr, err) + } + os.Exit(1) +} diff --git a/_tools/unicode-case-folding-map.json b/_tools/unicode-case-folding-map.json new file mode 100644 index 0000000..9d58ec0 --- /dev/null +++ b/_tools/unicode-case-folding-map.json @@ -0,0 +1,9309 @@ +{ + "data": [ + { + "From": "0x41", + "To": [ + "97" + ] + }, + { + "From": "0x42", + "To": [ + "98" + ] + }, + { + "From": "0x43", + "To": [ + "99" + ] + }, + { + "From": "0x44", + "To": [ + "100" + ] + }, + { + "From": "0x45", + "To": [ + "101" + ] + }, + { + "From": "0x46", + "To": [ + "102" + ] + }, + { + "From": "0x47", + "To": [ + "103" + ] + }, + { + "From": "0x48", + "To": [ + "104" + ] + }, + { + "From": "0x49", + "To": [ + "105" + ] + }, + { + "From": "0x4a", + "To": [ + "106" + ] + }, + { + "From": "0x4b", + "To": [ + "107" + ] + }, + { + "From": "0x4c", + "To": [ + "108" + ] + }, + { + "From": "0x4d", + "To": [ + "109" + ] + }, + { + "From": "0x4e", + "To": [ + "110" + ] + }, + { + "From": "0x4f", + "To": [ + "111" + ] + }, + { + "From": "0x50", + "To": [ + "112" + ] + }, + { + "From": "0x51", + "To": [ + "113" + ] + }, + { + "From": "0x52", + "To": [ + "114" + ] + }, + { + "From": "0x53", + "To": [ + "115" + ] + }, + { + "From": "0x54", + "To": [ + "116" + ] + }, + { + "From": "0x55", + "To": [ + "117" + ] + }, + { + "From": "0x56", + "To": [ + "118" + ] + }, + { + "From": "0x57", + "To": [ + "119" + ] + }, + { + "From": "0x58", + "To": [ + "120" + ] + }, + { + "From": "0x59", + "To": [ + "121" + ] + }, + { + "From": "0x5a", + "To": [ + "122" + ] + }, + { + "From": "0xb5", + "To": [ + "956" + ] + }, + { + "From": "0xc0", + "To": [ + "224" + ] + }, + { + "From": "0xc1", + "To": [ + "225" + ] + }, + { + "From": "0xc2", + "To": [ + "226" + ] + }, + { + "From": "0xc3", + "To": [ + "227" + ] + }, + { + "From": "0xc4", + "To": [ + "228" + ] + }, + { + "From": "0xc5", + "To": [ + "229" + ] + }, + { + "From": "0xc6", + "To": [ + "230" + ] + }, + { + "From": "0xc7", + "To": [ + "231" + ] + }, + { + "From": "0xc8", + "To": [ + "232" + ] + }, + { + "From": "0xc9", + "To": [ + "233" + ] + }, + { + "From": "0xca", + "To": [ + "234" + ] + }, + { + "From": "0xcb", + "To": [ + "235" + ] + }, + { + "From": "0xcc", + "To": [ + "236" + ] + }, + { + "From": "0xcd", + "To": [ + "237" + ] + }, + { + "From": "0xce", + "To": [ + "238" + ] + }, + { + "From": "0xcf", + "To": [ + "239" + ] + }, + { + "From": "0xd0", + "To": [ + "240" + ] + }, + { + "From": "0xd1", + "To": [ + "241" + ] + }, + { + "From": "0xd2", + "To": [ + "242" + ] + }, + { + "From": "0xd3", + "To": [ + "243" + ] + }, + { + "From": "0xd4", + "To": [ + "244" + ] + }, + { + "From": "0xd5", + "To": [ + "245" + ] + }, + { + "From": "0xd6", + "To": [ + "246" + ] + }, + { + "From": "0xd8", + "To": [ + "248" + ] + }, + { + "From": "0xd9", + "To": [ + "249" + ] + }, + { + "From": "0xda", + "To": [ + "250" + ] + }, + { + "From": "0xdb", + "To": [ + "251" + ] + }, + { + "From": "0xdc", + "To": [ + "252" + ] + }, + { + "From": "0xdd", + "To": [ + "253" + ] + }, + { + "From": "0xde", + "To": [ + "254" + ] + }, + { + "From": "0xdf", + "To": [ + "115", + "115" + ] + }, + { + "From": "0x100", + "To": [ + "257" + ] + }, + { + "From": "0x102", + "To": [ + "259" + ] + }, + { + "From": "0x104", + "To": [ + "261" + ] + }, + { + "From": "0x106", + "To": [ + "263" + ] + }, + { + "From": "0x108", + "To": [ + "265" + ] + }, + { + "From": "0x10a", + "To": [ + "267" + ] + }, + { + "From": "0x10c", + "To": [ + "269" + ] + }, + { + "From": "0x10e", + "To": [ + "271" + ] + }, + { + "From": "0x110", + "To": [ + "273" + ] + }, + { + "From": "0x112", + "To": [ + "275" + ] + }, + { + "From": "0x114", + "To": [ + "277" + ] + }, + { + "From": "0x116", + "To": [ + "279" + ] + }, + { + "From": "0x118", + "To": [ + "281" + ] + }, + { + "From": "0x11a", + "To": [ + "283" + ] + }, + { + "From": "0x11c", + "To": [ + "285" + ] + }, + { + "From": "0x11e", + "To": [ + "287" + ] + }, + { + "From": "0x120", + "To": [ + "289" + ] + }, + { + "From": "0x122", + "To": [ + "291" + ] + }, + { + "From": "0x124", + "To": [ + "293" + ] + }, + { + "From": "0x126", + "To": [ + "295" + ] + }, + { + "From": "0x128", + "To": [ + "297" + ] + }, + { + "From": "0x12a", + "To": [ + "299" + ] + }, + { + "From": "0x12c", + "To": [ + "301" + ] + }, + { + "From": "0x12e", + "To": [ + "303" + ] + }, + { + "From": "0x130", + "To": [ + "105", + "775" + ] + }, + { + "From": "0x132", + "To": [ + "307" + ] + }, + { + "From": "0x134", + "To": [ + "309" + ] + }, + { + "From": "0x136", + "To": [ + "311" + ] + }, + { + "From": "0x139", + "To": [ + "314" + ] + }, + { + "From": "0x13b", + "To": [ + "316" + ] + }, + { + "From": "0x13d", + "To": [ + "318" + ] + }, + { + "From": "0x13f", + "To": [ + "320" + ] + }, + { + "From": "0x141", + "To": [ + "322" + ] + }, + { + "From": "0x143", + "To": [ + "324" + ] + }, + { + "From": "0x145", + "To": [ + "326" + ] + }, + { + "From": "0x147", + "To": [ + "328" + ] + }, + { + "From": "0x149", + "To": [ + "700", + "110" + ] + }, + { + "From": "0x14a", + "To": [ + "331" + ] + }, + { + "From": "0x14c", + "To": [ + "333" + ] + }, + { + "From": "0x14e", + "To": [ + "335" + ] + }, + { + "From": "0x150", + "To": [ + "337" + ] + }, + { + "From": "0x152", + "To": [ + "339" + ] + }, + { + "From": "0x154", + "To": [ + "341" + ] + }, + { + "From": "0x156", + "To": [ + "343" + ] + }, + { + "From": "0x158", + "To": [ + "345" + ] + }, + { + "From": "0x15a", + "To": [ + "347" + ] + }, + { + "From": "0x15c", + "To": [ + "349" + ] + }, + { + "From": "0x15e", + "To": [ + "351" + ] + }, + { + "From": "0x160", + "To": [ + "353" + ] + }, + { + "From": "0x162", + "To": [ + "355" + ] + }, + { + "From": "0x164", + "To": [ + "357" + ] + }, + { + "From": "0x166", + "To": [ + "359" + ] + }, + { + "From": "0x168", + "To": [ + "361" + ] + }, + { + "From": "0x16a", + "To": [ + "363" + ] + }, + { + "From": "0x16c", + "To": [ + "365" + ] + }, + { + "From": "0x16e", + "To": [ + "367" + ] + }, + { + "From": "0x170", + "To": [ + "369" + ] + }, + { + "From": "0x172", + "To": [ + "371" + ] + }, + { + "From": "0x174", + "To": [ + "373" + ] + }, + { + "From": "0x176", + "To": [ + "375" + ] + }, + { + "From": "0x178", + "To": [ + "255" + ] + }, + { + "From": "0x179", + "To": [ + "378" + ] + }, + { + "From": "0x17b", + "To": [ + "380" + ] + }, + { + "From": "0x17d", + "To": [ + "382" + ] + }, + { + "From": "0x17f", + "To": [ + "115" + ] + }, + { + "From": "0x181", + "To": [ + "595" + ] + }, + { + "From": "0x182", + "To": [ + "387" + ] + }, + { + "From": "0x184", + "To": [ + "389" + ] + }, + { + "From": "0x186", + "To": [ + "596" + ] + }, + { + "From": "0x187", + "To": [ + "392" + ] + }, + { + "From": "0x189", + "To": [ + "598" + ] + }, + { + "From": "0x18a", + "To": [ + "599" + ] + }, + { + "From": "0x18b", + "To": [ + "396" + ] + }, + { + "From": "0x18e", + "To": [ + "477" + ] + }, + { + "From": "0x18f", + "To": [ + "601" + ] + }, + { + "From": "0x190", + "To": [ + "603" + ] + }, + { + "From": "0x191", + "To": [ + "402" + ] + }, + { + "From": "0x193", + "To": [ + "608" + ] + }, + { + "From": "0x194", + "To": [ + "611" + ] + }, + { + "From": "0x196", + "To": [ + "617" + ] + }, + { + "From": "0x197", + "To": [ + "616" + ] + }, + { + "From": "0x198", + "To": [ + "409" + ] + }, + { + "From": "0x19c", + "To": [ + "623" + ] + }, + { + "From": "0x19d", + "To": [ + "626" + ] + }, + { + "From": "0x19f", + "To": [ + "629" + ] + }, + { + "From": "0x1a0", + "To": [ + "417" + ] + }, + { + "From": "0x1a2", + "To": [ + "419" + ] + }, + { + "From": "0x1a4", + "To": [ + "421" + ] + }, + { + "From": "0x1a6", + "To": [ + "640" + ] + }, + { + "From": "0x1a7", + "To": [ + "424" + ] + }, + { + "From": "0x1a9", + "To": [ + "643" + ] + }, + { + "From": "0x1ac", + "To": [ + "429" + ] + }, + { + "From": "0x1ae", + "To": [ + "648" + ] + }, + { + "From": "0x1af", + "To": [ + "432" + ] + }, + { + "From": "0x1b1", + "To": [ + "650" + ] + }, + { + "From": "0x1b2", + "To": [ + "651" + ] + }, + { + "From": "0x1b3", + "To": [ + "436" + ] + }, + { + "From": "0x1b5", + "To": [ + "438" + ] + }, + { + "From": "0x1b7", + "To": [ + "658" + ] + }, + { + "From": "0x1b8", + "To": [ + "441" + ] + }, + { + "From": "0x1bc", + "To": [ + "445" + ] + }, + { + "From": "0x1c4", + "To": [ + "454" + ] + }, + { + "From": "0x1c5", + "To": [ + "454" + ] + }, + { + "From": "0x1c7", + "To": [ + "457" + ] + }, + { + "From": "0x1c8", + "To": [ + "457" + ] + }, + { + "From": "0x1ca", + "To": [ + "460" + ] + }, + { + "From": "0x1cb", + "To": [ + "460" + ] + }, + { + "From": "0x1cd", + "To": [ + "462" + ] + }, + { + "From": "0x1cf", + "To": [ + "464" + ] + }, + { + "From": "0x1d1", + "To": [ + "466" + ] + }, + { + "From": "0x1d3", + "To": [ + "468" + ] + }, + { + "From": "0x1d5", + "To": [ + "470" + ] + }, + { + "From": "0x1d7", + "To": [ + "472" + ] + }, + { + "From": "0x1d9", + "To": [ + "474" + ] + }, + { + "From": "0x1db", + "To": [ + "476" + ] + }, + { + "From": "0x1de", + "To": [ + "479" + ] + }, + { + "From": "0x1e0", + "To": [ + "481" + ] + }, + { + "From": "0x1e2", + "To": [ + "483" + ] + }, + { + "From": "0x1e4", + "To": [ + "485" + ] + }, + { + "From": "0x1e6", + "To": [ + "487" + ] + }, + { + "From": "0x1e8", + "To": [ + "489" + ] + }, + { + "From": "0x1ea", + "To": [ + "491" + ] + }, + { + "From": "0x1ec", + "To": [ + "493" + ] + }, + { + "From": "0x1ee", + "To": [ + "495" + ] + }, + { + "From": "0x1f0", + "To": [ + "106", + "780" + ] + }, + { + "From": "0x1f1", + "To": [ + "499" + ] + }, + { + "From": "0x1f2", + "To": [ + "499" + ] + }, + { + "From": "0x1f4", + "To": [ + "501" + ] + }, + { + "From": "0x1f6", + "To": [ + "405" + ] + }, + { + "From": "0x1f7", + "To": [ + "447" + ] + }, + { + "From": "0x1f8", + "To": [ + "505" + ] + }, + { + "From": "0x1fa", + "To": [ + "507" + ] + }, + { + "From": "0x1fc", + "To": [ + "509" + ] + }, + { + "From": "0x1fe", + "To": [ + "511" + ] + }, + { + "From": "0x200", + "To": [ + "513" + ] + }, + { + "From": "0x202", + "To": [ + "515" + ] + }, + { + "From": "0x204", + "To": [ + "517" + ] + }, + { + "From": "0x206", + "To": [ + "519" + ] + }, + { + "From": "0x208", + "To": [ + "521" + ] + }, + { + "From": "0x20a", + "To": [ + "523" + ] + }, + { + "From": "0x20c", + "To": [ + "525" + ] + }, + { + "From": "0x20e", + "To": [ + "527" + ] + }, + { + "From": "0x210", + "To": [ + "529" + ] + }, + { + "From": "0x212", + "To": [ + "531" + ] + }, + { + "From": "0x214", + "To": [ + "533" + ] + }, + { + "From": "0x216", + "To": [ + "535" + ] + }, + { + "From": "0x218", + "To": [ + "537" + ] + }, + { + "From": "0x21a", + "To": [ + "539" + ] + }, + { + "From": "0x21c", + "To": [ + "541" + ] + }, + { + "From": "0x21e", + "To": [ + "543" + ] + }, + { + "From": "0x220", + "To": [ + "414" + ] + }, + { + "From": "0x222", + "To": [ + "547" + ] + }, + { + "From": "0x224", + "To": [ + "549" + ] + }, + { + "From": "0x226", + "To": [ + "551" + ] + }, + { + "From": "0x228", + "To": [ + "553" + ] + }, + { + "From": "0x22a", + "To": [ + "555" + ] + }, + { + "From": "0x22c", + "To": [ + "557" + ] + }, + { + "From": "0x22e", + "To": [ + "559" + ] + }, + { + "From": "0x230", + "To": [ + "561" + ] + }, + { + "From": "0x232", + "To": [ + "563" + ] + }, + { + "From": "0x23a", + "To": [ + "11365" + ] + }, + { + "From": "0x23b", + "To": [ + "572" + ] + }, + { + "From": "0x23d", + "To": [ + "410" + ] + }, + { + "From": "0x23e", + "To": [ + "11366" + ] + }, + { + "From": "0x241", + "To": [ + "578" + ] + }, + { + "From": "0x243", + "To": [ + "384" + ] + }, + { + "From": "0x244", + "To": [ + "649" + ] + }, + { + "From": "0x245", + "To": [ + "652" + ] + }, + { + "From": "0x246", + "To": [ + "583" + ] + }, + { + "From": "0x248", + "To": [ + "585" + ] + }, + { + "From": "0x24a", + "To": [ + "587" + ] + }, + { + "From": "0x24c", + "To": [ + "589" + ] + }, + { + "From": "0x24e", + "To": [ + "591" + ] + }, + { + "From": "0x345", + "To": [ + "953" + ] + }, + { + "From": "0x370", + "To": [ + "881" + ] + }, + { + "From": "0x372", + "To": [ + "883" + ] + }, + { + "From": "0x376", + "To": [ + "887" + ] + }, + { + "From": "0x37f", + "To": [ + "1011" + ] + }, + { + "From": "0x386", + "To": [ + "940" + ] + }, + { + "From": "0x388", + "To": [ + "941" + ] + }, + { + "From": "0x389", + "To": [ + "942" + ] + }, + { + "From": "0x38a", + "To": [ + "943" + ] + }, + { + "From": "0x38c", + "To": [ + "972" + ] + }, + { + "From": "0x38e", + "To": [ + "973" + ] + }, + { + "From": "0x38f", + "To": [ + "974" + ] + }, + { + "From": "0x390", + "To": [ + "953", + "776", + "769" + ] + }, + { + "From": "0x391", + "To": [ + "945" + ] + }, + { + "From": "0x392", + "To": [ + "946" + ] + }, + { + "From": "0x393", + "To": [ + "947" + ] + }, + { + "From": "0x394", + "To": [ + "948" + ] + }, + { + "From": "0x395", + "To": [ + "949" + ] + }, + { + "From": "0x396", + "To": [ + "950" + ] + }, + { + "From": "0x397", + "To": [ + "951" + ] + }, + { + "From": "0x398", + "To": [ + "952" + ] + }, + { + "From": "0x399", + "To": [ + "953" + ] + }, + { + "From": "0x39a", + "To": [ + "954" + ] + }, + { + "From": "0x39b", + "To": [ + "955" + ] + }, + { + "From": "0x39c", + "To": [ + "956" + ] + }, + { + "From": "0x39d", + "To": [ + "957" + ] + }, + { + "From": "0x39e", + "To": [ + "958" + ] + }, + { + "From": "0x39f", + "To": [ + "959" + ] + }, + { + "From": "0x3a0", + "To": [ + "960" + ] + }, + { + "From": "0x3a1", + "To": [ + "961" + ] + }, + { + "From": "0x3a3", + "To": [ + "963" + ] + }, + { + "From": "0x3a4", + "To": [ + "964" + ] + }, + { + "From": "0x3a5", + "To": [ + "965" + ] + }, + { + "From": "0x3a6", + "To": [ + "966" + ] + }, + { + "From": "0x3a7", + "To": [ + "967" + ] + }, + { + "From": "0x3a8", + "To": [ + "968" + ] + }, + { + "From": "0x3a9", + "To": [ + "969" + ] + }, + { + "From": "0x3aa", + "To": [ + "970" + ] + }, + { + "From": "0x3ab", + "To": [ + "971" + ] + }, + { + "From": "0x3b0", + "To": [ + "965", + "776", + "769" + ] + }, + { + "From": "0x3c2", + "To": [ + "963" + ] + }, + { + "From": "0x3cf", + "To": [ + "983" + ] + }, + { + "From": "0x3d0", + "To": [ + "946" + ] + }, + { + "From": "0x3d1", + "To": [ + "952" + ] + }, + { + "From": "0x3d5", + "To": [ + "966" + ] + }, + { + "From": "0x3d6", + "To": [ + "960" + ] + }, + { + "From": "0x3d8", + "To": [ + "985" + ] + }, + { + "From": "0x3da", + "To": [ + "987" + ] + }, + { + "From": "0x3dc", + "To": [ + "989" + ] + }, + { + "From": "0x3de", + "To": [ + "991" + ] + }, + { + "From": "0x3e0", + "To": [ + "993" + ] + }, + { + "From": "0x3e2", + "To": [ + "995" + ] + }, + { + "From": "0x3e4", + "To": [ + "997" + ] + }, + { + "From": "0x3e6", + "To": [ + "999" + ] + }, + { + "From": "0x3e8", + "To": [ + "1001" + ] + }, + { + "From": "0x3ea", + "To": [ + "1003" + ] + }, + { + "From": "0x3ec", + "To": [ + "1005" + ] + }, + { + "From": "0x3ee", + "To": [ + "1007" + ] + }, + { + "From": "0x3f0", + "To": [ + "954" + ] + }, + { + "From": "0x3f1", + "To": [ + "961" + ] + }, + { + "From": "0x3f4", + "To": [ + "952" + ] + }, + { + "From": "0x3f5", + "To": [ + "949" + ] + }, + { + "From": "0x3f7", + "To": [ + "1016" + ] + }, + { + "From": "0x3f9", + "To": [ + "1010" + ] + }, + { + "From": "0x3fa", + "To": [ + "1019" + ] + }, + { + "From": "0x3fd", + "To": [ + "891" + ] + }, + { + "From": "0x3fe", + "To": [ + "892" + ] + }, + { + "From": "0x3ff", + "To": [ + "893" + ] + }, + { + "From": "0x400", + "To": [ + "1104" + ] + }, + { + "From": "0x401", + "To": [ + "1105" + ] + }, + { + "From": "0x402", + "To": [ + "1106" + ] + }, + { + "From": "0x403", + "To": [ + "1107" + ] + }, + { + "From": "0x404", + "To": [ + "1108" + ] + }, + { + "From": "0x405", + "To": [ + "1109" + ] + }, + { + "From": "0x406", + "To": [ + "1110" + ] + }, + { + "From": "0x407", + "To": [ + "1111" + ] + }, + { + "From": "0x408", + "To": [ + "1112" + ] + }, + { + "From": "0x409", + "To": [ + "1113" + ] + }, + { + "From": "0x40a", + "To": [ + "1114" + ] + }, + { + "From": "0x40b", + "To": [ + "1115" + ] + }, + { + "From": "0x40c", + "To": [ + "1116" + ] + }, + { + "From": "0x40d", + "To": [ + "1117" + ] + }, + { + "From": "0x40e", + "To": [ + "1118" + ] + }, + { + "From": "0x40f", + "To": [ + "1119" + ] + }, + { + "From": "0x410", + "To": [ + "1072" + ] + }, + { + "From": "0x411", + "To": [ + "1073" + ] + }, + { + "From": "0x412", + "To": [ + "1074" + ] + }, + { + "From": "0x413", + "To": [ + "1075" + ] + }, + { + "From": "0x414", + "To": [ + "1076" + ] + }, + { + "From": "0x415", + "To": [ + "1077" + ] + }, + { + "From": "0x416", + "To": [ + "1078" + ] + }, + { + "From": "0x417", + "To": [ + "1079" + ] + }, + { + "From": "0x418", + "To": [ + "1080" + ] + }, + { + "From": "0x419", + "To": [ + "1081" + ] + }, + { + "From": "0x41a", + "To": [ + "1082" + ] + }, + { + "From": "0x41b", + "To": [ + "1083" + ] + }, + { + "From": "0x41c", + "To": [ + "1084" + ] + }, + { + "From": "0x41d", + "To": [ + "1085" + ] + }, + { + "From": "0x41e", + "To": [ + "1086" + ] + }, + { + "From": "0x41f", + "To": [ + "1087" + ] + }, + { + "From": "0x420", + "To": [ + "1088" + ] + }, + { + "From": "0x421", + "To": [ + "1089" + ] + }, + { + "From": "0x422", + "To": [ + "1090" + ] + }, + { + "From": "0x423", + "To": [ + "1091" + ] + }, + { + "From": "0x424", + "To": [ + "1092" + ] + }, + { + "From": "0x425", + "To": [ + "1093" + ] + }, + { + "From": "0x426", + "To": [ + "1094" + ] + }, + { + "From": "0x427", + "To": [ + "1095" + ] + }, + { + "From": "0x428", + "To": [ + "1096" + ] + }, + { + "From": "0x429", + "To": [ + "1097" + ] + }, + { + "From": "0x42a", + "To": [ + "1098" + ] + }, + { + "From": "0x42b", + "To": [ + "1099" + ] + }, + { + "From": "0x42c", + "To": [ + "1100" + ] + }, + { + "From": "0x42d", + "To": [ + "1101" + ] + }, + { + "From": "0x42e", + "To": [ + "1102" + ] + }, + { + "From": "0x42f", + "To": [ + "1103" + ] + }, + { + "From": "0x460", + "To": [ + "1121" + ] + }, + { + "From": "0x462", + "To": [ + "1123" + ] + }, + { + "From": "0x464", + "To": [ + "1125" + ] + }, + { + "From": "0x466", + "To": [ + "1127" + ] + }, + { + "From": "0x468", + "To": [ + "1129" + ] + }, + { + "From": "0x46a", + "To": [ + "1131" + ] + }, + { + "From": "0x46c", + "To": [ + "1133" + ] + }, + { + "From": "0x46e", + "To": [ + "1135" + ] + }, + { + "From": "0x470", + "To": [ + "1137" + ] + }, + { + "From": "0x472", + "To": [ + "1139" + ] + }, + { + "From": "0x474", + "To": [ + "1141" + ] + }, + { + "From": "0x476", + "To": [ + "1143" + ] + }, + { + "From": "0x478", + "To": [ + "1145" + ] + }, + { + "From": "0x47a", + "To": [ + "1147" + ] + }, + { + "From": "0x47c", + "To": [ + "1149" + ] + }, + { + "From": "0x47e", + "To": [ + "1151" + ] + }, + { + "From": "0x480", + "To": [ + "1153" + ] + }, + { + "From": "0x48a", + "To": [ + "1163" + ] + }, + { + "From": "0x48c", + "To": [ + "1165" + ] + }, + { + "From": "0x48e", + "To": [ + "1167" + ] + }, + { + "From": "0x490", + "To": [ + "1169" + ] + }, + { + "From": "0x492", + "To": [ + "1171" + ] + }, + { + "From": "0x494", + "To": [ + "1173" + ] + }, + { + "From": "0x496", + "To": [ + "1175" + ] + }, + { + "From": "0x498", + "To": [ + "1177" + ] + }, + { + "From": "0x49a", + "To": [ + "1179" + ] + }, + { + "From": "0x49c", + "To": [ + "1181" + ] + }, + { + "From": "0x49e", + "To": [ + "1183" + ] + }, + { + "From": "0x4a0", + "To": [ + "1185" + ] + }, + { + "From": "0x4a2", + "To": [ + "1187" + ] + }, + { + "From": "0x4a4", + "To": [ + "1189" + ] + }, + { + "From": "0x4a6", + "To": [ + "1191" + ] + }, + { + "From": "0x4a8", + "To": [ + "1193" + ] + }, + { + "From": "0x4aa", + "To": [ + "1195" + ] + }, + { + "From": "0x4ac", + "To": [ + "1197" + ] + }, + { + "From": "0x4ae", + "To": [ + "1199" + ] + }, + { + "From": "0x4b0", + "To": [ + "1201" + ] + }, + { + "From": "0x4b2", + "To": [ + "1203" + ] + }, + { + "From": "0x4b4", + "To": [ + "1205" + ] + }, + { + "From": "0x4b6", + "To": [ + "1207" + ] + }, + { + "From": "0x4b8", + "To": [ + "1209" + ] + }, + { + "From": "0x4ba", + "To": [ + "1211" + ] + }, + { + "From": "0x4bc", + "To": [ + "1213" + ] + }, + { + "From": "0x4be", + "To": [ + "1215" + ] + }, + { + "From": "0x4c0", + "To": [ + "1231" + ] + }, + { + "From": "0x4c1", + "To": [ + "1218" + ] + }, + { + "From": "0x4c3", + "To": [ + "1220" + ] + }, + { + "From": "0x4c5", + "To": [ + "1222" + ] + }, + { + "From": "0x4c7", + "To": [ + "1224" + ] + }, + { + "From": "0x4c9", + "To": [ + "1226" + ] + }, + { + "From": "0x4cb", + "To": [ + "1228" + ] + }, + { + "From": "0x4cd", + "To": [ + "1230" + ] + }, + { + "From": "0x4d0", + "To": [ + "1233" + ] + }, + { + "From": "0x4d2", + "To": [ + "1235" + ] + }, + { + "From": "0x4d4", + "To": [ + "1237" + ] + }, + { + "From": "0x4d6", + "To": [ + "1239" + ] + }, + { + "From": "0x4d8", + "To": [ + "1241" + ] + }, + { + "From": "0x4da", + "To": [ + "1243" + ] + }, + { + "From": "0x4dc", + "To": [ + "1245" + ] + }, + { + "From": "0x4de", + "To": [ + "1247" + ] + }, + { + "From": "0x4e0", + "To": [ + "1249" + ] + }, + { + "From": "0x4e2", + "To": [ + "1251" + ] + }, + { + "From": "0x4e4", + "To": [ + "1253" + ] + }, + { + "From": "0x4e6", + "To": [ + "1255" + ] + }, + { + "From": "0x4e8", + "To": [ + "1257" + ] + }, + { + "From": "0x4ea", + "To": [ + "1259" + ] + }, + { + "From": "0x4ec", + "To": [ + "1261" + ] + }, + { + "From": "0x4ee", + "To": [ + "1263" + ] + }, + { + "From": "0x4f0", + "To": [ + "1265" + ] + }, + { + "From": "0x4f2", + "To": [ + "1267" + ] + }, + { + "From": "0x4f4", + "To": [ + "1269" + ] + }, + { + "From": "0x4f6", + "To": [ + "1271" + ] + }, + { + "From": "0x4f8", + "To": [ + "1273" + ] + }, + { + "From": "0x4fa", + "To": [ + "1275" + ] + }, + { + "From": "0x4fc", + "To": [ + "1277" + ] + }, + { + "From": "0x4fe", + "To": [ + "1279" + ] + }, + { + "From": "0x500", + "To": [ + "1281" + ] + }, + { + "From": "0x502", + "To": [ + "1283" + ] + }, + { + "From": "0x504", + "To": [ + "1285" + ] + }, + { + "From": "0x506", + "To": [ + "1287" + ] + }, + { + "From": "0x508", + "To": [ + "1289" + ] + }, + { + "From": "0x50a", + "To": [ + "1291" + ] + }, + { + "From": "0x50c", + "To": [ + "1293" + ] + }, + { + "From": "0x50e", + "To": [ + "1295" + ] + }, + { + "From": "0x510", + "To": [ + "1297" + ] + }, + { + "From": "0x512", + "To": [ + "1299" + ] + }, + { + "From": "0x514", + "To": [ + "1301" + ] + }, + { + "From": "0x516", + "To": [ + "1303" + ] + }, + { + "From": "0x518", + "To": [ + "1305" + ] + }, + { + "From": "0x51a", + "To": [ + "1307" + ] + }, + { + "From": "0x51c", + "To": [ + "1309" + ] + }, + { + "From": "0x51e", + "To": [ + "1311" + ] + }, + { + "From": "0x520", + "To": [ + "1313" + ] + }, + { + "From": "0x522", + "To": [ + "1315" + ] + }, + { + "From": "0x524", + "To": [ + "1317" + ] + }, + { + "From": "0x526", + "To": [ + "1319" + ] + }, + { + "From": "0x528", + "To": [ + "1321" + ] + }, + { + "From": "0x52a", + "To": [ + "1323" + ] + }, + { + "From": "0x52c", + "To": [ + "1325" + ] + }, + { + "From": "0x52e", + "To": [ + "1327" + ] + }, + { + "From": "0x531", + "To": [ + "1377" + ] + }, + { + "From": "0x532", + "To": [ + "1378" + ] + }, + { + "From": "0x533", + "To": [ + "1379" + ] + }, + { + "From": "0x534", + "To": [ + "1380" + ] + }, + { + "From": "0x535", + "To": [ + "1381" + ] + }, + { + "From": "0x536", + "To": [ + "1382" + ] + }, + { + "From": "0x537", + "To": [ + "1383" + ] + }, + { + "From": "0x538", + "To": [ + "1384" + ] + }, + { + "From": "0x539", + "To": [ + "1385" + ] + }, + { + "From": "0x53a", + "To": [ + "1386" + ] + }, + { + "From": "0x53b", + "To": [ + "1387" + ] + }, + { + "From": "0x53c", + "To": [ + "1388" + ] + }, + { + "From": "0x53d", + "To": [ + "1389" + ] + }, + { + "From": "0x53e", + "To": [ + "1390" + ] + }, + { + "From": "0x53f", + "To": [ + "1391" + ] + }, + { + "From": "0x540", + "To": [ + "1392" + ] + }, + { + "From": "0x541", + "To": [ + "1393" + ] + }, + { + "From": "0x542", + "To": [ + "1394" + ] + }, + { + "From": "0x543", + "To": [ + "1395" + ] + }, + { + "From": "0x544", + "To": [ + "1396" + ] + }, + { + "From": "0x545", + "To": [ + "1397" + ] + }, + { + "From": "0x546", + "To": [ + "1398" + ] + }, + { + "From": "0x547", + "To": [ + "1399" + ] + }, + { + "From": "0x548", + "To": [ + "1400" + ] + }, + { + "From": "0x549", + "To": [ + "1401" + ] + }, + { + "From": "0x54a", + "To": [ + "1402" + ] + }, + { + "From": "0x54b", + "To": [ + "1403" + ] + }, + { + "From": "0x54c", + "To": [ + "1404" + ] + }, + { + "From": "0x54d", + "To": [ + "1405" + ] + }, + { + "From": "0x54e", + "To": [ + "1406" + ] + }, + { + "From": "0x54f", + "To": [ + "1407" + ] + }, + { + "From": "0x550", + "To": [ + "1408" + ] + }, + { + "From": "0x551", + "To": [ + "1409" + ] + }, + { + "From": "0x552", + "To": [ + "1410" + ] + }, + { + "From": "0x553", + "To": [ + "1411" + ] + }, + { + "From": "0x554", + "To": [ + "1412" + ] + }, + { + "From": "0x555", + "To": [ + "1413" + ] + }, + { + "From": "0x556", + "To": [ + "1414" + ] + }, + { + "From": "0x587", + "To": [ + "1381", + "1410" + ] + }, + { + "From": "0x10a0", + "To": [ + "11520" + ] + }, + { + "From": "0x10a1", + "To": [ + "11521" + ] + }, + { + "From": "0x10a2", + "To": [ + "11522" + ] + }, + { + "From": "0x10a3", + "To": [ + "11523" + ] + }, + { + "From": "0x10a4", + "To": [ + "11524" + ] + }, + { + "From": "0x10a5", + "To": [ + "11525" + ] + }, + { + "From": "0x10a6", + "To": [ + "11526" + ] + }, + { + "From": "0x10a7", + "To": [ + "11527" + ] + }, + { + "From": "0x10a8", + "To": [ + "11528" + ] + }, + { + "From": "0x10a9", + "To": [ + "11529" + ] + }, + { + "From": "0x10aa", + "To": [ + "11530" + ] + }, + { + "From": "0x10ab", + "To": [ + "11531" + ] + }, + { + "From": "0x10ac", + "To": [ + "11532" + ] + }, + { + "From": "0x10ad", + "To": [ + "11533" + ] + }, + { + "From": "0x10ae", + "To": [ + "11534" + ] + }, + { + "From": "0x10af", + "To": [ + "11535" + ] + }, + { + "From": "0x10b0", + "To": [ + "11536" + ] + }, + { + "From": "0x10b1", + "To": [ + "11537" + ] + }, + { + "From": "0x10b2", + "To": [ + "11538" + ] + }, + { + "From": "0x10b3", + "To": [ + "11539" + ] + }, + { + "From": "0x10b4", + "To": [ + "11540" + ] + }, + { + "From": "0x10b5", + "To": [ + "11541" + ] + }, + { + "From": "0x10b6", + "To": [ + "11542" + ] + }, + { + "From": "0x10b7", + "To": [ + "11543" + ] + }, + { + "From": "0x10b8", + "To": [ + "11544" + ] + }, + { + "From": "0x10b9", + "To": [ + "11545" + ] + }, + { + "From": "0x10ba", + "To": [ + "11546" + ] + }, + { + "From": "0x10bb", + "To": [ + "11547" + ] + }, + { + "From": "0x10bc", + "To": [ + "11548" + ] + }, + { + "From": "0x10bd", + "To": [ + "11549" + ] + }, + { + "From": "0x10be", + "To": [ + "11550" + ] + }, + { + "From": "0x10bf", + "To": [ + "11551" + ] + }, + { + "From": "0x10c0", + "To": [ + "11552" + ] + }, + { + "From": "0x10c1", + "To": [ + "11553" + ] + }, + { + "From": "0x10c2", + "To": [ + "11554" + ] + }, + { + "From": "0x10c3", + "To": [ + "11555" + ] + }, + { + "From": "0x10c4", + "To": [ + "11556" + ] + }, + { + "From": "0x10c5", + "To": [ + "11557" + ] + }, + { + "From": "0x10c7", + "To": [ + "11559" + ] + }, + { + "From": "0x10cd", + "To": [ + "11565" + ] + }, + { + "From": "0x13f8", + "To": [ + "5104" + ] + }, + { + "From": "0x13f9", + "To": [ + "5105" + ] + }, + { + "From": "0x13fa", + "To": [ + "5106" + ] + }, + { + "From": "0x13fb", + "To": [ + "5107" + ] + }, + { + "From": "0x13fc", + "To": [ + "5108" + ] + }, + { + "From": "0x13fd", + "To": [ + "5109" + ] + }, + { + "From": "0x1c80", + "To": [ + "1074" + ] + }, + { + "From": "0x1c81", + "To": [ + "1076" + ] + }, + { + "From": "0x1c82", + "To": [ + "1086" + ] + }, + { + "From": "0x1c83", + "To": [ + "1089" + ] + }, + { + "From": "0x1c84", + "To": [ + "1090" + ] + }, + { + "From": "0x1c85", + "To": [ + "1090" + ] + }, + { + "From": "0x1c86", + "To": [ + "1098" + ] + }, + { + "From": "0x1c87", + "To": [ + "1123" + ] + }, + { + "From": "0x1c88", + "To": [ + "42571" + ] + }, + { + "From": "0x1c90", + "To": [ + "4304" + ] + }, + { + "From": "0x1c91", + "To": [ + "4305" + ] + }, + { + "From": "0x1c92", + "To": [ + "4306" + ] + }, + { + "From": "0x1c93", + "To": [ + "4307" + ] + }, + { + "From": "0x1c94", + "To": [ + "4308" + ] + }, + { + "From": "0x1c95", + "To": [ + "4309" + ] + }, + { + "From": "0x1c96", + "To": [ + "4310" + ] + }, + { + "From": "0x1c97", + "To": [ + "4311" + ] + }, + { + "From": "0x1c98", + "To": [ + "4312" + ] + }, + { + "From": "0x1c99", + "To": [ + "4313" + ] + }, + { + "From": "0x1c9a", + "To": [ + "4314" + ] + }, + { + "From": "0x1c9b", + "To": [ + "4315" + ] + }, + { + "From": "0x1c9c", + "To": [ + "4316" + ] + }, + { + "From": "0x1c9d", + "To": [ + "4317" + ] + }, + { + "From": "0x1c9e", + "To": [ + "4318" + ] + }, + { + "From": "0x1c9f", + "To": [ + "4319" + ] + }, + { + "From": "0x1ca0", + "To": [ + "4320" + ] + }, + { + "From": "0x1ca1", + "To": [ + "4321" + ] + }, + { + "From": "0x1ca2", + "To": [ + "4322" + ] + }, + { + "From": "0x1ca3", + "To": [ + "4323" + ] + }, + { + "From": "0x1ca4", + "To": [ + "4324" + ] + }, + { + "From": "0x1ca5", + "To": [ + "4325" + ] + }, + { + "From": "0x1ca6", + "To": [ + "4326" + ] + }, + { + "From": "0x1ca7", + "To": [ + "4327" + ] + }, + { + "From": "0x1ca8", + "To": [ + "4328" + ] + }, + { + "From": "0x1ca9", + "To": [ + "4329" + ] + }, + { + "From": "0x1caa", + "To": [ + "4330" + ] + }, + { + "From": "0x1cab", + "To": [ + "4331" + ] + }, + { + "From": "0x1cac", + "To": [ + "4332" + ] + }, + { + "From": "0x1cad", + "To": [ + "4333" + ] + }, + { + "From": "0x1cae", + "To": [ + "4334" + ] + }, + { + "From": "0x1caf", + "To": [ + "4335" + ] + }, + { + "From": "0x1cb0", + "To": [ + "4336" + ] + }, + { + "From": "0x1cb1", + "To": [ + "4337" + ] + }, + { + "From": "0x1cb2", + "To": [ + "4338" + ] + }, + { + "From": "0x1cb3", + "To": [ + "4339" + ] + }, + { + "From": "0x1cb4", + "To": [ + "4340" + ] + }, + { + "From": "0x1cb5", + "To": [ + "4341" + ] + }, + { + "From": "0x1cb6", + "To": [ + "4342" + ] + }, + { + "From": "0x1cb7", + "To": [ + "4343" + ] + }, + { + "From": "0x1cb8", + "To": [ + "4344" + ] + }, + { + "From": "0x1cb9", + "To": [ + "4345" + ] + }, + { + "From": "0x1cba", + "To": [ + "4346" + ] + }, + { + "From": "0x1cbd", + "To": [ + "4349" + ] + }, + { + "From": "0x1cbe", + "To": [ + "4350" + ] + }, + { + "From": "0x1cbf", + "To": [ + "4351" + ] + }, + { + "From": "0x1e00", + "To": [ + "7681" + ] + }, + { + "From": "0x1e02", + "To": [ + "7683" + ] + }, + { + "From": "0x1e04", + "To": [ + "7685" + ] + }, + { + "From": "0x1e06", + "To": [ + "7687" + ] + }, + { + "From": "0x1e08", + "To": [ + "7689" + ] + }, + { + "From": "0x1e0a", + "To": [ + "7691" + ] + }, + { + "From": "0x1e0c", + "To": [ + "7693" + ] + }, + { + "From": "0x1e0e", + "To": [ + "7695" + ] + }, + { + "From": "0x1e10", + "To": [ + "7697" + ] + }, + { + "From": "0x1e12", + "To": [ + "7699" + ] + }, + { + "From": "0x1e14", + "To": [ + "7701" + ] + }, + { + "From": "0x1e16", + "To": [ + "7703" + ] + }, + { + "From": "0x1e18", + "To": [ + "7705" + ] + }, + { + "From": "0x1e1a", + "To": [ + "7707" + ] + }, + { + "From": "0x1e1c", + "To": [ + "7709" + ] + }, + { + "From": "0x1e1e", + "To": [ + "7711" + ] + }, + { + "From": "0x1e20", + "To": [ + "7713" + ] + }, + { + "From": "0x1e22", + "To": [ + "7715" + ] + }, + { + "From": "0x1e24", + "To": [ + "7717" + ] + }, + { + "From": "0x1e26", + "To": [ + "7719" + ] + }, + { + "From": "0x1e28", + "To": [ + "7721" + ] + }, + { + "From": "0x1e2a", + "To": [ + "7723" + ] + }, + { + "From": "0x1e2c", + "To": [ + "7725" + ] + }, + { + "From": "0x1e2e", + "To": [ + "7727" + ] + }, + { + "From": "0x1e30", + "To": [ + "7729" + ] + }, + { + "From": "0x1e32", + "To": [ + "7731" + ] + }, + { + "From": "0x1e34", + "To": [ + "7733" + ] + }, + { + "From": "0x1e36", + "To": [ + "7735" + ] + }, + { + "From": "0x1e38", + "To": [ + "7737" + ] + }, + { + "From": "0x1e3a", + "To": [ + "7739" + ] + }, + { + "From": "0x1e3c", + "To": [ + "7741" + ] + }, + { + "From": "0x1e3e", + "To": [ + "7743" + ] + }, + { + "From": "0x1e40", + "To": [ + "7745" + ] + }, + { + "From": "0x1e42", + "To": [ + "7747" + ] + }, + { + "From": "0x1e44", + "To": [ + "7749" + ] + }, + { + "From": "0x1e46", + "To": [ + "7751" + ] + }, + { + "From": "0x1e48", + "To": [ + "7753" + ] + }, + { + "From": "0x1e4a", + "To": [ + "7755" + ] + }, + { + "From": "0x1e4c", + "To": [ + "7757" + ] + }, + { + "From": "0x1e4e", + "To": [ + "7759" + ] + }, + { + "From": "0x1e50", + "To": [ + "7761" + ] + }, + { + "From": "0x1e52", + "To": [ + "7763" + ] + }, + { + "From": "0x1e54", + "To": [ + "7765" + ] + }, + { + "From": "0x1e56", + "To": [ + "7767" + ] + }, + { + "From": "0x1e58", + "To": [ + "7769" + ] + }, + { + "From": "0x1e5a", + "To": [ + "7771" + ] + }, + { + "From": "0x1e5c", + "To": [ + "7773" + ] + }, + { + "From": "0x1e5e", + "To": [ + "7775" + ] + }, + { + "From": "0x1e60", + "To": [ + "7777" + ] + }, + { + "From": "0x1e62", + "To": [ + "7779" + ] + }, + { + "From": "0x1e64", + "To": [ + "7781" + ] + }, + { + "From": "0x1e66", + "To": [ + "7783" + ] + }, + { + "From": "0x1e68", + "To": [ + "7785" + ] + }, + { + "From": "0x1e6a", + "To": [ + "7787" + ] + }, + { + "From": "0x1e6c", + "To": [ + "7789" + ] + }, + { + "From": "0x1e6e", + "To": [ + "7791" + ] + }, + { + "From": "0x1e70", + "To": [ + "7793" + ] + }, + { + "From": "0x1e72", + "To": [ + "7795" + ] + }, + { + "From": "0x1e74", + "To": [ + "7797" + ] + }, + { + "From": "0x1e76", + "To": [ + "7799" + ] + }, + { + "From": "0x1e78", + "To": [ + "7801" + ] + }, + { + "From": "0x1e7a", + "To": [ + "7803" + ] + }, + { + "From": "0x1e7c", + "To": [ + "7805" + ] + }, + { + "From": "0x1e7e", + "To": [ + "7807" + ] + }, + { + "From": "0x1e80", + "To": [ + "7809" + ] + }, + { + "From": "0x1e82", + "To": [ + "7811" + ] + }, + { + "From": "0x1e84", + "To": [ + "7813" + ] + }, + { + "From": "0x1e86", + "To": [ + "7815" + ] + }, + { + "From": "0x1e88", + "To": [ + "7817" + ] + }, + { + "From": "0x1e8a", + "To": [ + "7819" + ] + }, + { + "From": "0x1e8c", + "To": [ + "7821" + ] + }, + { + "From": "0x1e8e", + "To": [ + "7823" + ] + }, + { + "From": "0x1e90", + "To": [ + "7825" + ] + }, + { + "From": "0x1e92", + "To": [ + "7827" + ] + }, + { + "From": "0x1e94", + "To": [ + "7829" + ] + }, + { + "From": "0x1e96", + "To": [ + "104", + "817" + ] + }, + { + "From": "0x1e97", + "To": [ + "116", + "776" + ] + }, + { + "From": "0x1e98", + "To": [ + "119", + "778" + ] + }, + { + "From": "0x1e99", + "To": [ + "121", + "778" + ] + }, + { + "From": "0x1e9a", + "To": [ + "97", + "702" + ] + }, + { + "From": "0x1e9b", + "To": [ + "7777" + ] + }, + { + "From": "0x1e9e", + "To": [ + "115", + "115" + ] + }, + { + "From": "0x1ea0", + "To": [ + "7841" + ] + }, + { + "From": "0x1ea2", + "To": [ + "7843" + ] + }, + { + "From": "0x1ea4", + "To": [ + "7845" + ] + }, + { + "From": "0x1ea6", + "To": [ + "7847" + ] + }, + { + "From": "0x1ea8", + "To": [ + "7849" + ] + }, + { + "From": "0x1eaa", + "To": [ + "7851" + ] + }, + { + "From": "0x1eac", + "To": [ + "7853" + ] + }, + { + "From": "0x1eae", + "To": [ + "7855" + ] + }, + { + "From": "0x1eb0", + "To": [ + "7857" + ] + }, + { + "From": "0x1eb2", + "To": [ + "7859" + ] + }, + { + "From": "0x1eb4", + "To": [ + "7861" + ] + }, + { + "From": "0x1eb6", + "To": [ + "7863" + ] + }, + { + "From": "0x1eb8", + "To": [ + "7865" + ] + }, + { + "From": "0x1eba", + "To": [ + "7867" + ] + }, + { + "From": "0x1ebc", + "To": [ + "7869" + ] + }, + { + "From": "0x1ebe", + "To": [ + "7871" + ] + }, + { + "From": "0x1ec0", + "To": [ + "7873" + ] + }, + { + "From": "0x1ec2", + "To": [ + "7875" + ] + }, + { + "From": "0x1ec4", + "To": [ + "7877" + ] + }, + { + "From": "0x1ec6", + "To": [ + "7879" + ] + }, + { + "From": "0x1ec8", + "To": [ + "7881" + ] + }, + { + "From": "0x1eca", + "To": [ + "7883" + ] + }, + { + "From": "0x1ecc", + "To": [ + "7885" + ] + }, + { + "From": "0x1ece", + "To": [ + "7887" + ] + }, + { + "From": "0x1ed0", + "To": [ + "7889" + ] + }, + { + "From": "0x1ed2", + "To": [ + "7891" + ] + }, + { + "From": "0x1ed4", + "To": [ + "7893" + ] + }, + { + "From": "0x1ed6", + "To": [ + "7895" + ] + }, + { + "From": "0x1ed8", + "To": [ + "7897" + ] + }, + { + "From": "0x1eda", + "To": [ + "7899" + ] + }, + { + "From": "0x1edc", + "To": [ + "7901" + ] + }, + { + "From": "0x1ede", + "To": [ + "7903" + ] + }, + { + "From": "0x1ee0", + "To": [ + "7905" + ] + }, + { + "From": "0x1ee2", + "To": [ + "7907" + ] + }, + { + "From": "0x1ee4", + "To": [ + "7909" + ] + }, + { + "From": "0x1ee6", + "To": [ + "7911" + ] + }, + { + "From": "0x1ee8", + "To": [ + "7913" + ] + }, + { + "From": "0x1eea", + "To": [ + "7915" + ] + }, + { + "From": "0x1eec", + "To": [ + "7917" + ] + }, + { + "From": "0x1eee", + "To": [ + "7919" + ] + }, + { + "From": "0x1ef0", + "To": [ + "7921" + ] + }, + { + "From": "0x1ef2", + "To": [ + "7923" + ] + }, + { + "From": "0x1ef4", + "To": [ + "7925" + ] + }, + { + "From": "0x1ef6", + "To": [ + "7927" + ] + }, + { + "From": "0x1ef8", + "To": [ + "7929" + ] + }, + { + "From": "0x1efa", + "To": [ + "7931" + ] + }, + { + "From": "0x1efc", + "To": [ + "7933" + ] + }, + { + "From": "0x1efe", + "To": [ + "7935" + ] + }, + { + "From": "0x1f08", + "To": [ + "7936" + ] + }, + { + "From": "0x1f09", + "To": [ + "7937" + ] + }, + { + "From": "0x1f0a", + "To": [ + "7938" + ] + }, + { + "From": "0x1f0b", + "To": [ + "7939" + ] + }, + { + "From": "0x1f0c", + "To": [ + "7940" + ] + }, + { + "From": "0x1f0d", + "To": [ + "7941" + ] + }, + { + "From": "0x1f0e", + "To": [ + "7942" + ] + }, + { + "From": "0x1f0f", + "To": [ + "7943" + ] + }, + { + "From": "0x1f18", + "To": [ + "7952" + ] + }, + { + "From": "0x1f19", + "To": [ + "7953" + ] + }, + { + "From": "0x1f1a", + "To": [ + "7954" + ] + }, + { + "From": "0x1f1b", + "To": [ + "7955" + ] + }, + { + "From": "0x1f1c", + "To": [ + "7956" + ] + }, + { + "From": "0x1f1d", + "To": [ + "7957" + ] + }, + { + "From": "0x1f28", + "To": [ + "7968" + ] + }, + { + "From": "0x1f29", + "To": [ + "7969" + ] + }, + { + "From": "0x1f2a", + "To": [ + "7970" + ] + }, + { + "From": "0x1f2b", + "To": [ + "7971" + ] + }, + { + "From": "0x1f2c", + "To": [ + "7972" + ] + }, + { + "From": "0x1f2d", + "To": [ + "7973" + ] + }, + { + "From": "0x1f2e", + "To": [ + "7974" + ] + }, + { + "From": "0x1f2f", + "To": [ + "7975" + ] + }, + { + "From": "0x1f38", + "To": [ + "7984" + ] + }, + { + "From": "0x1f39", + "To": [ + "7985" + ] + }, + { + "From": "0x1f3a", + "To": [ + "7986" + ] + }, + { + "From": "0x1f3b", + "To": [ + "7987" + ] + }, + { + "From": "0x1f3c", + "To": [ + "7988" + ] + }, + { + "From": "0x1f3d", + "To": [ + "7989" + ] + }, + { + "From": "0x1f3e", + "To": [ + "7990" + ] + }, + { + "From": "0x1f3f", + "To": [ + "7991" + ] + }, + { + "From": "0x1f48", + "To": [ + "8000" + ] + }, + { + "From": "0x1f49", + "To": [ + "8001" + ] + }, + { + "From": "0x1f4a", + "To": [ + "8002" + ] + }, + { + "From": "0x1f4b", + "To": [ + "8003" + ] + }, + { + "From": "0x1f4c", + "To": [ + "8004" + ] + }, + { + "From": "0x1f4d", + "To": [ + "8005" + ] + }, + { + "From": "0x1f50", + "To": [ + "965", + "787" + ] + }, + { + "From": "0x1f52", + "To": [ + "965", + "787", + "768" + ] + }, + { + "From": "0x1f54", + "To": [ + "965", + "787", + "769" + ] + }, + { + "From": "0x1f56", + "To": [ + "965", + "787", + "834" + ] + }, + { + "From": "0x1f59", + "To": [ + "8017" + ] + }, + { + "From": "0x1f5b", + "To": [ + "8019" + ] + }, + { + "From": "0x1f5d", + "To": [ + "8021" + ] + }, + { + "From": "0x1f5f", + "To": [ + "8023" + ] + }, + { + "From": "0x1f68", + "To": [ + "8032" + ] + }, + { + "From": "0x1f69", + "To": [ + "8033" + ] + }, + { + "From": "0x1f6a", + "To": [ + "8034" + ] + }, + { + "From": "0x1f6b", + "To": [ + "8035" + ] + }, + { + "From": "0x1f6c", + "To": [ + "8036" + ] + }, + { + "From": "0x1f6d", + "To": [ + "8037" + ] + }, + { + "From": "0x1f6e", + "To": [ + "8038" + ] + }, + { + "From": "0x1f6f", + "To": [ + "8039" + ] + }, + { + "From": "0x1f80", + "To": [ + "7936", + "953" + ] + }, + { + "From": "0x1f81", + "To": [ + "7937", + "953" + ] + }, + { + "From": "0x1f82", + "To": [ + "7938", + "953" + ] + }, + { + "From": "0x1f83", + "To": [ + "7939", + "953" + ] + }, + { + "From": "0x1f84", + "To": [ + "7940", + "953" + ] + }, + { + "From": "0x1f85", + "To": [ + "7941", + "953" + ] + }, + { + "From": "0x1f86", + "To": [ + "7942", + "953" + ] + }, + { + "From": "0x1f87", + "To": [ + "7943", + "953" + ] + }, + { + "From": "0x1f88", + "To": [ + "7936", + "953" + ] + }, + { + "From": "0x1f89", + "To": [ + "7937", + "953" + ] + }, + { + "From": "0x1f8a", + "To": [ + "7938", + "953" + ] + }, + { + "From": "0x1f8b", + "To": [ + "7939", + "953" + ] + }, + { + "From": "0x1f8c", + "To": [ + "7940", + "953" + ] + }, + { + "From": "0x1f8d", + "To": [ + "7941", + "953" + ] + }, + { + "From": "0x1f8e", + "To": [ + "7942", + "953" + ] + }, + { + "From": "0x1f8f", + "To": [ + "7943", + "953" + ] + }, + { + "From": "0x1f90", + "To": [ + "7968", + "953" + ] + }, + { + "From": "0x1f91", + "To": [ + "7969", + "953" + ] + }, + { + "From": "0x1f92", + "To": [ + "7970", + "953" + ] + }, + { + "From": "0x1f93", + "To": [ + "7971", + "953" + ] + }, + { + "From": "0x1f94", + "To": [ + "7972", + "953" + ] + }, + { + "From": "0x1f95", + "To": [ + "7973", + "953" + ] + }, + { + "From": "0x1f96", + "To": [ + "7974", + "953" + ] + }, + { + "From": "0x1f97", + "To": [ + "7975", + "953" + ] + }, + { + "From": "0x1f98", + "To": [ + "7968", + "953" + ] + }, + { + "From": "0x1f99", + "To": [ + "7969", + "953" + ] + }, + { + "From": "0x1f9a", + "To": [ + "7970", + "953" + ] + }, + { + "From": "0x1f9b", + "To": [ + "7971", + "953" + ] + }, + { + "From": "0x1f9c", + "To": [ + "7972", + "953" + ] + }, + { + "From": "0x1f9d", + "To": [ + "7973", + "953" + ] + }, + { + "From": "0x1f9e", + "To": [ + "7974", + "953" + ] + }, + { + "From": "0x1f9f", + "To": [ + "7975", + "953" + ] + }, + { + "From": "0x1fa0", + "To": [ + "8032", + "953" + ] + }, + { + "From": "0x1fa1", + "To": [ + "8033", + "953" + ] + }, + { + "From": "0x1fa2", + "To": [ + "8034", + "953" + ] + }, + { + "From": "0x1fa3", + "To": [ + "8035", + "953" + ] + }, + { + "From": "0x1fa4", + "To": [ + "8036", + "953" + ] + }, + { + "From": "0x1fa5", + "To": [ + "8037", + "953" + ] + }, + { + "From": "0x1fa6", + "To": [ + "8038", + "953" + ] + }, + { + "From": "0x1fa7", + "To": [ + "8039", + "953" + ] + }, + { + "From": "0x1fa8", + "To": [ + "8032", + "953" + ] + }, + { + "From": "0x1fa9", + "To": [ + "8033", + "953" + ] + }, + { + "From": "0x1faa", + "To": [ + "8034", + "953" + ] + }, + { + "From": "0x1fab", + "To": [ + "8035", + "953" + ] + }, + { + "From": "0x1fac", + "To": [ + "8036", + "953" + ] + }, + { + "From": "0x1fad", + "To": [ + "8037", + "953" + ] + }, + { + "From": "0x1fae", + "To": [ + "8038", + "953" + ] + }, + { + "From": "0x1faf", + "To": [ + "8039", + "953" + ] + }, + { + "From": "0x1fb2", + "To": [ + "8048", + "953" + ] + }, + { + "From": "0x1fb3", + "To": [ + "945", + "953" + ] + }, + { + "From": "0x1fb4", + "To": [ + "940", + "953" + ] + }, + { + "From": "0x1fb6", + "To": [ + "945", + "834" + ] + }, + { + "From": "0x1fb7", + "To": [ + "945", + "834", + "953" + ] + }, + { + "From": "0x1fb8", + "To": [ + "8112" + ] + }, + { + "From": "0x1fb9", + "To": [ + "8113" + ] + }, + { + "From": "0x1fba", + "To": [ + "8048" + ] + }, + { + "From": "0x1fbb", + "To": [ + "8049" + ] + }, + { + "From": "0x1fbc", + "To": [ + "945", + "953" + ] + }, + { + "From": "0x1fbe", + "To": [ + "953" + ] + }, + { + "From": "0x1fc2", + "To": [ + "8052", + "953" + ] + }, + { + "From": "0x1fc3", + "To": [ + "951", + "953" + ] + }, + { + "From": "0x1fc4", + "To": [ + "942", + "953" + ] + }, + { + "From": "0x1fc6", + "To": [ + "951", + "834" + ] + }, + { + "From": "0x1fc7", + "To": [ + "951", + "834", + "953" + ] + }, + { + "From": "0x1fc8", + "To": [ + "8050" + ] + }, + { + "From": "0x1fc9", + "To": [ + "8051" + ] + }, + { + "From": "0x1fca", + "To": [ + "8052" + ] + }, + { + "From": "0x1fcb", + "To": [ + "8053" + ] + }, + { + "From": "0x1fcc", + "To": [ + "951", + "953" + ] + }, + { + "From": "0x1fd2", + "To": [ + "953", + "776", + "768" + ] + }, + { + "From": "0x1fd3", + "To": [ + "953", + "776", + "769" + ] + }, + { + "From": "0x1fd6", + "To": [ + "953", + "834" + ] + }, + { + "From": "0x1fd7", + "To": [ + "953", + "776", + "834" + ] + }, + { + "From": "0x1fd8", + "To": [ + "8144" + ] + }, + { + "From": "0x1fd9", + "To": [ + "8145" + ] + }, + { + "From": "0x1fda", + "To": [ + "8054" + ] + }, + { + "From": "0x1fdb", + "To": [ + "8055" + ] + }, + { + "From": "0x1fe2", + "To": [ + "965", + "776", + "768" + ] + }, + { + "From": "0x1fe3", + "To": [ + "965", + "776", + "769" + ] + }, + { + "From": "0x1fe4", + "To": [ + "961", + "787" + ] + }, + { + "From": "0x1fe6", + "To": [ + "965", + "834" + ] + }, + { + "From": "0x1fe7", + "To": [ + "965", + "776", + "834" + ] + }, + { + "From": "0x1fe8", + "To": [ + "8160" + ] + }, + { + "From": "0x1fe9", + "To": [ + "8161" + ] + }, + { + "From": "0x1fea", + "To": [ + "8058" + ] + }, + { + "From": "0x1feb", + "To": [ + "8059" + ] + }, + { + "From": "0x1fec", + "To": [ + "8165" + ] + }, + { + "From": "0x1ff2", + "To": [ + "8060", + "953" + ] + }, + { + "From": "0x1ff3", + "To": [ + "969", + "953" + ] + }, + { + "From": "0x1ff4", + "To": [ + "974", + "953" + ] + }, + { + "From": "0x1ff6", + "To": [ + "969", + "834" + ] + }, + { + "From": "0x1ff7", + "To": [ + "969", + "834", + "953" + ] + }, + { + "From": "0x1ff8", + "To": [ + "8056" + ] + }, + { + "From": "0x1ff9", + "To": [ + "8057" + ] + }, + { + "From": "0x1ffa", + "To": [ + "8060" + ] + }, + { + "From": "0x1ffb", + "To": [ + "8061" + ] + }, + { + "From": "0x1ffc", + "To": [ + "969", + "953" + ] + }, + { + "From": "0x2126", + "To": [ + "969" + ] + }, + { + "From": "0x212a", + "To": [ + "107" + ] + }, + { + "From": "0x212b", + "To": [ + "229" + ] + }, + { + "From": "0x2132", + "To": [ + "8526" + ] + }, + { + "From": "0x2160", + "To": [ + "8560" + ] + }, + { + "From": "0x2161", + "To": [ + "8561" + ] + }, + { + "From": "0x2162", + "To": [ + "8562" + ] + }, + { + "From": "0x2163", + "To": [ + "8563" + ] + }, + { + "From": "0x2164", + "To": [ + "8564" + ] + }, + { + "From": "0x2165", + "To": [ + "8565" + ] + }, + { + "From": "0x2166", + "To": [ + "8566" + ] + }, + { + "From": "0x2167", + "To": [ + "8567" + ] + }, + { + "From": "0x2168", + "To": [ + "8568" + ] + }, + { + "From": "0x2169", + "To": [ + "8569" + ] + }, + { + "From": "0x216a", + "To": [ + "8570" + ] + }, + { + "From": "0x216b", + "To": [ + "8571" + ] + }, + { + "From": "0x216c", + "To": [ + "8572" + ] + }, + { + "From": "0x216d", + "To": [ + "8573" + ] + }, + { + "From": "0x216e", + "To": [ + "8574" + ] + }, + { + "From": "0x216f", + "To": [ + "8575" + ] + }, + { + "From": "0x2183", + "To": [ + "8580" + ] + }, + { + "From": "0x24b6", + "To": [ + "9424" + ] + }, + { + "From": "0x24b7", + "To": [ + "9425" + ] + }, + { + "From": "0x24b8", + "To": [ + "9426" + ] + }, + { + "From": "0x24b9", + "To": [ + "9427" + ] + }, + { + "From": "0x24ba", + "To": [ + "9428" + ] + }, + { + "From": "0x24bb", + "To": [ + "9429" + ] + }, + { + "From": "0x24bc", + "To": [ + "9430" + ] + }, + { + "From": "0x24bd", + "To": [ + "9431" + ] + }, + { + "From": "0x24be", + "To": [ + "9432" + ] + }, + { + "From": "0x24bf", + "To": [ + "9433" + ] + }, + { + "From": "0x24c0", + "To": [ + "9434" + ] + }, + { + "From": "0x24c1", + "To": [ + "9435" + ] + }, + { + "From": "0x24c2", + "To": [ + "9436" + ] + }, + { + "From": "0x24c3", + "To": [ + "9437" + ] + }, + { + "From": "0x24c4", + "To": [ + "9438" + ] + }, + { + "From": "0x24c5", + "To": [ + "9439" + ] + }, + { + "From": "0x24c6", + "To": [ + "9440" + ] + }, + { + "From": "0x24c7", + "To": [ + "9441" + ] + }, + { + "From": "0x24c8", + "To": [ + "9442" + ] + }, + { + "From": "0x24c9", + "To": [ + "9443" + ] + }, + { + "From": "0x24ca", + "To": [ + "9444" + ] + }, + { + "From": "0x24cb", + "To": [ + "9445" + ] + }, + { + "From": "0x24cc", + "To": [ + "9446" + ] + }, + { + "From": "0x24cd", + "To": [ + "9447" + ] + }, + { + "From": "0x24ce", + "To": [ + "9448" + ] + }, + { + "From": "0x24cf", + "To": [ + "9449" + ] + }, + { + "From": "0x2c00", + "To": [ + "11312" + ] + }, + { + "From": "0x2c01", + "To": [ + "11313" + ] + }, + { + "From": "0x2c02", + "To": [ + "11314" + ] + }, + { + "From": "0x2c03", + "To": [ + "11315" + ] + }, + { + "From": "0x2c04", + "To": [ + "11316" + ] + }, + { + "From": "0x2c05", + "To": [ + "11317" + ] + }, + { + "From": "0x2c06", + "To": [ + "11318" + ] + }, + { + "From": "0x2c07", + "To": [ + "11319" + ] + }, + { + "From": "0x2c08", + "To": [ + "11320" + ] + }, + { + "From": "0x2c09", + "To": [ + "11321" + ] + }, + { + "From": "0x2c0a", + "To": [ + "11322" + ] + }, + { + "From": "0x2c0b", + "To": [ + "11323" + ] + }, + { + "From": "0x2c0c", + "To": [ + "11324" + ] + }, + { + "From": "0x2c0d", + "To": [ + "11325" + ] + }, + { + "From": "0x2c0e", + "To": [ + "11326" + ] + }, + { + "From": "0x2c0f", + "To": [ + "11327" + ] + }, + { + "From": "0x2c10", + "To": [ + "11328" + ] + }, + { + "From": "0x2c11", + "To": [ + "11329" + ] + }, + { + "From": "0x2c12", + "To": [ + "11330" + ] + }, + { + "From": "0x2c13", + "To": [ + "11331" + ] + }, + { + "From": "0x2c14", + "To": [ + "11332" + ] + }, + { + "From": "0x2c15", + "To": [ + "11333" + ] + }, + { + "From": "0x2c16", + "To": [ + "11334" + ] + }, + { + "From": "0x2c17", + "To": [ + "11335" + ] + }, + { + "From": "0x2c18", + "To": [ + "11336" + ] + }, + { + "From": "0x2c19", + "To": [ + "11337" + ] + }, + { + "From": "0x2c1a", + "To": [ + "11338" + ] + }, + { + "From": "0x2c1b", + "To": [ + "11339" + ] + }, + { + "From": "0x2c1c", + "To": [ + "11340" + ] + }, + { + "From": "0x2c1d", + "To": [ + "11341" + ] + }, + { + "From": "0x2c1e", + "To": [ + "11342" + ] + }, + { + "From": "0x2c1f", + "To": [ + "11343" + ] + }, + { + "From": "0x2c20", + "To": [ + "11344" + ] + }, + { + "From": "0x2c21", + "To": [ + "11345" + ] + }, + { + "From": "0x2c22", + "To": [ + "11346" + ] + }, + { + "From": "0x2c23", + "To": [ + "11347" + ] + }, + { + "From": "0x2c24", + "To": [ + "11348" + ] + }, + { + "From": "0x2c25", + "To": [ + "11349" + ] + }, + { + "From": "0x2c26", + "To": [ + "11350" + ] + }, + { + "From": "0x2c27", + "To": [ + "11351" + ] + }, + { + "From": "0x2c28", + "To": [ + "11352" + ] + }, + { + "From": "0x2c29", + "To": [ + "11353" + ] + }, + { + "From": "0x2c2a", + "To": [ + "11354" + ] + }, + { + "From": "0x2c2b", + "To": [ + "11355" + ] + }, + { + "From": "0x2c2c", + "To": [ + "11356" + ] + }, + { + "From": "0x2c2d", + "To": [ + "11357" + ] + }, + { + "From": "0x2c2e", + "To": [ + "11358" + ] + }, + { + "From": "0x2c2f", + "To": [ + "11359" + ] + }, + { + "From": "0x2c60", + "To": [ + "11361" + ] + }, + { + "From": "0x2c62", + "To": [ + "619" + ] + }, + { + "From": "0x2c63", + "To": [ + "7549" + ] + }, + { + "From": "0x2c64", + "To": [ + "637" + ] + }, + { + "From": "0x2c67", + "To": [ + "11368" + ] + }, + { + "From": "0x2c69", + "To": [ + "11370" + ] + }, + { + "From": "0x2c6b", + "To": [ + "11372" + ] + }, + { + "From": "0x2c6d", + "To": [ + "593" + ] + }, + { + "From": "0x2c6e", + "To": [ + "625" + ] + }, + { + "From": "0x2c6f", + "To": [ + "592" + ] + }, + { + "From": "0x2c70", + "To": [ + "594" + ] + }, + { + "From": "0x2c72", + "To": [ + "11379" + ] + }, + { + "From": "0x2c75", + "To": [ + "11382" + ] + }, + { + "From": "0x2c7e", + "To": [ + "575" + ] + }, + { + "From": "0x2c7f", + "To": [ + "576" + ] + }, + { + "From": "0x2c80", + "To": [ + "11393" + ] + }, + { + "From": "0x2c82", + "To": [ + "11395" + ] + }, + { + "From": "0x2c84", + "To": [ + "11397" + ] + }, + { + "From": "0x2c86", + "To": [ + "11399" + ] + }, + { + "From": "0x2c88", + "To": [ + "11401" + ] + }, + { + "From": "0x2c8a", + "To": [ + "11403" + ] + }, + { + "From": "0x2c8c", + "To": [ + "11405" + ] + }, + { + "From": "0x2c8e", + "To": [ + "11407" + ] + }, + { + "From": "0x2c90", + "To": [ + "11409" + ] + }, + { + "From": "0x2c92", + "To": [ + "11411" + ] + }, + { + "From": "0x2c94", + "To": [ + "11413" + ] + }, + { + "From": "0x2c96", + "To": [ + "11415" + ] + }, + { + "From": "0x2c98", + "To": [ + "11417" + ] + }, + { + "From": "0x2c9a", + "To": [ + "11419" + ] + }, + { + "From": "0x2c9c", + "To": [ + "11421" + ] + }, + { + "From": "0x2c9e", + "To": [ + "11423" + ] + }, + { + "From": "0x2ca0", + "To": [ + "11425" + ] + }, + { + "From": "0x2ca2", + "To": [ + "11427" + ] + }, + { + "From": "0x2ca4", + "To": [ + "11429" + ] + }, + { + "From": "0x2ca6", + "To": [ + "11431" + ] + }, + { + "From": "0x2ca8", + "To": [ + "11433" + ] + }, + { + "From": "0x2caa", + "To": [ + "11435" + ] + }, + { + "From": "0x2cac", + "To": [ + "11437" + ] + }, + { + "From": "0x2cae", + "To": [ + "11439" + ] + }, + { + "From": "0x2cb0", + "To": [ + "11441" + ] + }, + { + "From": "0x2cb2", + "To": [ + "11443" + ] + }, + { + "From": "0x2cb4", + "To": [ + "11445" + ] + }, + { + "From": "0x2cb6", + "To": [ + "11447" + ] + }, + { + "From": "0x2cb8", + "To": [ + "11449" + ] + }, + { + "From": "0x2cba", + "To": [ + "11451" + ] + }, + { + "From": "0x2cbc", + "To": [ + "11453" + ] + }, + { + "From": "0x2cbe", + "To": [ + "11455" + ] + }, + { + "From": "0x2cc0", + "To": [ + "11457" + ] + }, + { + "From": "0x2cc2", + "To": [ + "11459" + ] + }, + { + "From": "0x2cc4", + "To": [ + "11461" + ] + }, + { + "From": "0x2cc6", + "To": [ + "11463" + ] + }, + { + "From": "0x2cc8", + "To": [ + "11465" + ] + }, + { + "From": "0x2cca", + "To": [ + "11467" + ] + }, + { + "From": "0x2ccc", + "To": [ + "11469" + ] + }, + { + "From": "0x2cce", + "To": [ + "11471" + ] + }, + { + "From": "0x2cd0", + "To": [ + "11473" + ] + }, + { + "From": "0x2cd2", + "To": [ + "11475" + ] + }, + { + "From": "0x2cd4", + "To": [ + "11477" + ] + }, + { + "From": "0x2cd6", + "To": [ + "11479" + ] + }, + { + "From": "0x2cd8", + "To": [ + "11481" + ] + }, + { + "From": "0x2cda", + "To": [ + "11483" + ] + }, + { + "From": "0x2cdc", + "To": [ + "11485" + ] + }, + { + "From": "0x2cde", + "To": [ + "11487" + ] + }, + { + "From": "0x2ce0", + "To": [ + "11489" + ] + }, + { + "From": "0x2ce2", + "To": [ + "11491" + ] + }, + { + "From": "0x2ceb", + "To": [ + "11500" + ] + }, + { + "From": "0x2ced", + "To": [ + "11502" + ] + }, + { + "From": "0x2cf2", + "To": [ + "11507" + ] + }, + { + "From": "0xa640", + "To": [ + "42561" + ] + }, + { + "From": "0xa642", + "To": [ + "42563" + ] + }, + { + "From": "0xa644", + "To": [ + "42565" + ] + }, + { + "From": "0xa646", + "To": [ + "42567" + ] + }, + { + "From": "0xa648", + "To": [ + "42569" + ] + }, + { + "From": "0xa64a", + "To": [ + "42571" + ] + }, + { + "From": "0xa64c", + "To": [ + "42573" + ] + }, + { + "From": "0xa64e", + "To": [ + "42575" + ] + }, + { + "From": "0xa650", + "To": [ + "42577" + ] + }, + { + "From": "0xa652", + "To": [ + "42579" + ] + }, + { + "From": "0xa654", + "To": [ + "42581" + ] + }, + { + "From": "0xa656", + "To": [ + "42583" + ] + }, + { + "From": "0xa658", + "To": [ + "42585" + ] + }, + { + "From": "0xa65a", + "To": [ + "42587" + ] + }, + { + "From": "0xa65c", + "To": [ + "42589" + ] + }, + { + "From": "0xa65e", + "To": [ + "42591" + ] + }, + { + "From": "0xa660", + "To": [ + "42593" + ] + }, + { + "From": "0xa662", + "To": [ + "42595" + ] + }, + { + "From": "0xa664", + "To": [ + "42597" + ] + }, + { + "From": "0xa666", + "To": [ + "42599" + ] + }, + { + "From": "0xa668", + "To": [ + "42601" + ] + }, + { + "From": "0xa66a", + "To": [ + "42603" + ] + }, + { + "From": "0xa66c", + "To": [ + "42605" + ] + }, + { + "From": "0xa680", + "To": [ + "42625" + ] + }, + { + "From": "0xa682", + "To": [ + "42627" + ] + }, + { + "From": "0xa684", + "To": [ + "42629" + ] + }, + { + "From": "0xa686", + "To": [ + "42631" + ] + }, + { + "From": "0xa688", + "To": [ + "42633" + ] + }, + { + "From": "0xa68a", + "To": [ + "42635" + ] + }, + { + "From": "0xa68c", + "To": [ + "42637" + ] + }, + { + "From": "0xa68e", + "To": [ + "42639" + ] + }, + { + "From": "0xa690", + "To": [ + "42641" + ] + }, + { + "From": "0xa692", + "To": [ + "42643" + ] + }, + { + "From": "0xa694", + "To": [ + "42645" + ] + }, + { + "From": "0xa696", + "To": [ + "42647" + ] + }, + { + "From": "0xa698", + "To": [ + "42649" + ] + }, + { + "From": "0xa69a", + "To": [ + "42651" + ] + }, + { + "From": "0xa722", + "To": [ + "42787" + ] + }, + { + "From": "0xa724", + "To": [ + "42789" + ] + }, + { + "From": "0xa726", + "To": [ + "42791" + ] + }, + { + "From": "0xa728", + "To": [ + "42793" + ] + }, + { + "From": "0xa72a", + "To": [ + "42795" + ] + }, + { + "From": "0xa72c", + "To": [ + "42797" + ] + }, + { + "From": "0xa72e", + "To": [ + "42799" + ] + }, + { + "From": "0xa732", + "To": [ + "42803" + ] + }, + { + "From": "0xa734", + "To": [ + "42805" + ] + }, + { + "From": "0xa736", + "To": [ + "42807" + ] + }, + { + "From": "0xa738", + "To": [ + "42809" + ] + }, + { + "From": "0xa73a", + "To": [ + "42811" + ] + }, + { + "From": "0xa73c", + "To": [ + "42813" + ] + }, + { + "From": "0xa73e", + "To": [ + "42815" + ] + }, + { + "From": "0xa740", + "To": [ + "42817" + ] + }, + { + "From": "0xa742", + "To": [ + "42819" + ] + }, + { + "From": "0xa744", + "To": [ + "42821" + ] + }, + { + "From": "0xa746", + "To": [ + "42823" + ] + }, + { + "From": "0xa748", + "To": [ + "42825" + ] + }, + { + "From": "0xa74a", + "To": [ + "42827" + ] + }, + { + "From": "0xa74c", + "To": [ + "42829" + ] + }, + { + "From": "0xa74e", + "To": [ + "42831" + ] + }, + { + "From": "0xa750", + "To": [ + "42833" + ] + }, + { + "From": "0xa752", + "To": [ + "42835" + ] + }, + { + "From": "0xa754", + "To": [ + "42837" + ] + }, + { + "From": "0xa756", + "To": [ + "42839" + ] + }, + { + "From": "0xa758", + "To": [ + "42841" + ] + }, + { + "From": "0xa75a", + "To": [ + "42843" + ] + }, + { + "From": "0xa75c", + "To": [ + "42845" + ] + }, + { + "From": "0xa75e", + "To": [ + "42847" + ] + }, + { + "From": "0xa760", + "To": [ + "42849" + ] + }, + { + "From": "0xa762", + "To": [ + "42851" + ] + }, + { + "From": "0xa764", + "To": [ + "42853" + ] + }, + { + "From": "0xa766", + "To": [ + "42855" + ] + }, + { + "From": "0xa768", + "To": [ + "42857" + ] + }, + { + "From": "0xa76a", + "To": [ + "42859" + ] + }, + { + "From": "0xa76c", + "To": [ + "42861" + ] + }, + { + "From": "0xa76e", + "To": [ + "42863" + ] + }, + { + "From": "0xa779", + "To": [ + "42874" + ] + }, + { + "From": "0xa77b", + "To": [ + "42876" + ] + }, + { + "From": "0xa77d", + "To": [ + "7545" + ] + }, + { + "From": "0xa77e", + "To": [ + "42879" + ] + }, + { + "From": "0xa780", + "To": [ + "42881" + ] + }, + { + "From": "0xa782", + "To": [ + "42883" + ] + }, + { + "From": "0xa784", + "To": [ + "42885" + ] + }, + { + "From": "0xa786", + "To": [ + "42887" + ] + }, + { + "From": "0xa78b", + "To": [ + "42892" + ] + }, + { + "From": "0xa78d", + "To": [ + "613" + ] + }, + { + "From": "0xa790", + "To": [ + "42897" + ] + }, + { + "From": "0xa792", + "To": [ + "42899" + ] + }, + { + "From": "0xa796", + "To": [ + "42903" + ] + }, + { + "From": "0xa798", + "To": [ + "42905" + ] + }, + { + "From": "0xa79a", + "To": [ + "42907" + ] + }, + { + "From": "0xa79c", + "To": [ + "42909" + ] + }, + { + "From": "0xa79e", + "To": [ + "42911" + ] + }, + { + "From": "0xa7a0", + "To": [ + "42913" + ] + }, + { + "From": "0xa7a2", + "To": [ + "42915" + ] + }, + { + "From": "0xa7a4", + "To": [ + "42917" + ] + }, + { + "From": "0xa7a6", + "To": [ + "42919" + ] + }, + { + "From": "0xa7a8", + "To": [ + "42921" + ] + }, + { + "From": "0xa7aa", + "To": [ + "614" + ] + }, + { + "From": "0xa7ab", + "To": [ + "604" + ] + }, + { + "From": "0xa7ac", + "To": [ + "609" + ] + }, + { + "From": "0xa7ad", + "To": [ + "620" + ] + }, + { + "From": "0xa7ae", + "To": [ + "618" + ] + }, + { + "From": "0xa7b0", + "To": [ + "670" + ] + }, + { + "From": "0xa7b1", + "To": [ + "647" + ] + }, + { + "From": "0xa7b2", + "To": [ + "669" + ] + }, + { + "From": "0xa7b3", + "To": [ + "43859" + ] + }, + { + "From": "0xa7b4", + "To": [ + "42933" + ] + }, + { + "From": "0xa7b6", + "To": [ + "42935" + ] + }, + { + "From": "0xa7b8", + "To": [ + "42937" + ] + }, + { + "From": "0xa7ba", + "To": [ + "42939" + ] + }, + { + "From": "0xa7bc", + "To": [ + "42941" + ] + }, + { + "From": "0xa7be", + "To": [ + "42943" + ] + }, + { + "From": "0xa7c0", + "To": [ + "42945" + ] + }, + { + "From": "0xa7c2", + "To": [ + "42947" + ] + }, + { + "From": "0xa7c4", + "To": [ + "42900" + ] + }, + { + "From": "0xa7c5", + "To": [ + "642" + ] + }, + { + "From": "0xa7c6", + "To": [ + "7566" + ] + }, + { + "From": "0xa7c7", + "To": [ + "42952" + ] + }, + { + "From": "0xa7c9", + "To": [ + "42954" + ] + }, + { + "From": "0xa7d0", + "To": [ + "42961" + ] + }, + { + "From": "0xa7d6", + "To": [ + "42967" + ] + }, + { + "From": "0xa7d8", + "To": [ + "42969" + ] + }, + { + "From": "0xa7f5", + "To": [ + "42998" + ] + }, + { + "From": "0xab70", + "To": [ + "5024" + ] + }, + { + "From": "0xab71", + "To": [ + "5025" + ] + }, + { + "From": "0xab72", + "To": [ + "5026" + ] + }, + { + "From": "0xab73", + "To": [ + "5027" + ] + }, + { + "From": "0xab74", + "To": [ + "5028" + ] + }, + { + "From": "0xab75", + "To": [ + "5029" + ] + }, + { + "From": "0xab76", + "To": [ + "5030" + ] + }, + { + "From": "0xab77", + "To": [ + "5031" + ] + }, + { + "From": "0xab78", + "To": [ + "5032" + ] + }, + { + "From": "0xab79", + "To": [ + "5033" + ] + }, + { + "From": "0xab7a", + "To": [ + "5034" + ] + }, + { + "From": "0xab7b", + "To": [ + "5035" + ] + }, + { + "From": "0xab7c", + "To": [ + "5036" + ] + }, + { + "From": "0xab7d", + "To": [ + "5037" + ] + }, + { + "From": "0xab7e", + "To": [ + "5038" + ] + }, + { + "From": "0xab7f", + "To": [ + "5039" + ] + }, + { + "From": "0xab80", + "To": [ + "5040" + ] + }, + { + "From": "0xab81", + "To": [ + "5041" + ] + }, + { + "From": "0xab82", + "To": [ + "5042" + ] + }, + { + "From": "0xab83", + "To": [ + "5043" + ] + }, + { + "From": "0xab84", + "To": [ + "5044" + ] + }, + { + "From": "0xab85", + "To": [ + "5045" + ] + }, + { + "From": "0xab86", + "To": [ + "5046" + ] + }, + { + "From": "0xab87", + "To": [ + "5047" + ] + }, + { + "From": "0xab88", + "To": [ + "5048" + ] + }, + { + "From": "0xab89", + "To": [ + "5049" + ] + }, + { + "From": "0xab8a", + "To": [ + "5050" + ] + }, + { + "From": "0xab8b", + "To": [ + "5051" + ] + }, + { + "From": "0xab8c", + "To": [ + "5052" + ] + }, + { + "From": "0xab8d", + "To": [ + "5053" + ] + }, + { + "From": "0xab8e", + "To": [ + "5054" + ] + }, + { + "From": "0xab8f", + "To": [ + "5055" + ] + }, + { + "From": "0xab90", + "To": [ + "5056" + ] + }, + { + "From": "0xab91", + "To": [ + "5057" + ] + }, + { + "From": "0xab92", + "To": [ + "5058" + ] + }, + { + "From": "0xab93", + "To": [ + "5059" + ] + }, + { + "From": "0xab94", + "To": [ + "5060" + ] + }, + { + "From": "0xab95", + "To": [ + "5061" + ] + }, + { + "From": "0xab96", + "To": [ + "5062" + ] + }, + { + "From": "0xab97", + "To": [ + "5063" + ] + }, + { + "From": "0xab98", + "To": [ + "5064" + ] + }, + { + "From": "0xab99", + "To": [ + "5065" + ] + }, + { + "From": "0xab9a", + "To": [ + "5066" + ] + }, + { + "From": "0xab9b", + "To": [ + "5067" + ] + }, + { + "From": "0xab9c", + "To": [ + "5068" + ] + }, + { + "From": "0xab9d", + "To": [ + "5069" + ] + }, + { + "From": "0xab9e", + "To": [ + "5070" + ] + }, + { + "From": "0xab9f", + "To": [ + "5071" + ] + }, + { + "From": "0xaba0", + "To": [ + "5072" + ] + }, + { + "From": "0xaba1", + "To": [ + "5073" + ] + }, + { + "From": "0xaba2", + "To": [ + "5074" + ] + }, + { + "From": "0xaba3", + "To": [ + "5075" + ] + }, + { + "From": "0xaba4", + "To": [ + "5076" + ] + }, + { + "From": "0xaba5", + "To": [ + "5077" + ] + }, + { + "From": "0xaba6", + "To": [ + "5078" + ] + }, + { + "From": "0xaba7", + "To": [ + "5079" + ] + }, + { + "From": "0xaba8", + "To": [ + "5080" + ] + }, + { + "From": "0xaba9", + "To": [ + "5081" + ] + }, + { + "From": "0xabaa", + "To": [ + "5082" + ] + }, + { + "From": "0xabab", + "To": [ + "5083" + ] + }, + { + "From": "0xabac", + "To": [ + "5084" + ] + }, + { + "From": "0xabad", + "To": [ + "5085" + ] + }, + { + "From": "0xabae", + "To": [ + "5086" + ] + }, + { + "From": "0xabaf", + "To": [ + "5087" + ] + }, + { + "From": "0xabb0", + "To": [ + "5088" + ] + }, + { + "From": "0xabb1", + "To": [ + "5089" + ] + }, + { + "From": "0xabb2", + "To": [ + "5090" + ] + }, + { + "From": "0xabb3", + "To": [ + "5091" + ] + }, + { + "From": "0xabb4", + "To": [ + "5092" + ] + }, + { + "From": "0xabb5", + "To": [ + "5093" + ] + }, + { + "From": "0xabb6", + "To": [ + "5094" + ] + }, + { + "From": "0xabb7", + "To": [ + "5095" + ] + }, + { + "From": "0xabb8", + "To": [ + "5096" + ] + }, + { + "From": "0xabb9", + "To": [ + "5097" + ] + }, + { + "From": "0xabba", + "To": [ + "5098" + ] + }, + { + "From": "0xabbb", + "To": [ + "5099" + ] + }, + { + "From": "0xabbc", + "To": [ + "5100" + ] + }, + { + "From": "0xabbd", + "To": [ + "5101" + ] + }, + { + "From": "0xabbe", + "To": [ + "5102" + ] + }, + { + "From": "0xabbf", + "To": [ + "5103" + ] + }, + { + "From": "0xfb00", + "To": [ + "102", + "102" + ] + }, + { + "From": "0xfb01", + "To": [ + "102", + "105" + ] + }, + { + "From": "0xfb02", + "To": [ + "102", + "108" + ] + }, + { + "From": "0xfb03", + "To": [ + "102", + "102", + "105" + ] + }, + { + "From": "0xfb04", + "To": [ + "102", + "102", + "108" + ] + }, + { + "From": "0xfb05", + "To": [ + "115", + "116" + ] + }, + { + "From": "0xfb06", + "To": [ + "115", + "116" + ] + }, + { + "From": "0xfb13", + "To": [ + "1396", + "1398" + ] + }, + { + "From": "0xfb14", + "To": [ + "1396", + "1381" + ] + }, + { + "From": "0xfb15", + "To": [ + "1396", + "1387" + ] + }, + { + "From": "0xfb16", + "To": [ + "1406", + "1398" + ] + }, + { + "From": "0xfb17", + "To": [ + "1396", + "1389" + ] + }, + { + "From": "0xff21", + "To": [ + "65345" + ] + }, + { + "From": "0xff22", + "To": [ + "65346" + ] + }, + { + "From": "0xff23", + "To": [ + "65347" + ] + }, + { + "From": "0xff24", + "To": [ + "65348" + ] + }, + { + "From": "0xff25", + "To": [ + "65349" + ] + }, + { + "From": "0xff26", + "To": [ + "65350" + ] + }, + { + "From": "0xff27", + "To": [ + "65351" + ] + }, + { + "From": "0xff28", + "To": [ + "65352" + ] + }, + { + "From": "0xff29", + "To": [ + "65353" + ] + }, + { + "From": "0xff2a", + "To": [ + "65354" + ] + }, + { + "From": "0xff2b", + "To": [ + "65355" + ] + }, + { + "From": "0xff2c", + "To": [ + "65356" + ] + }, + { + "From": "0xff2d", + "To": [ + "65357" + ] + }, + { + "From": "0xff2e", + "To": [ + "65358" + ] + }, + { + "From": "0xff2f", + "To": [ + "65359" + ] + }, + { + "From": "0xff30", + "To": [ + "65360" + ] + }, + { + "From": "0xff31", + "To": [ + "65361" + ] + }, + { + "From": "0xff32", + "To": [ + "65362" + ] + }, + { + "From": "0xff33", + "To": [ + "65363" + ] + }, + { + "From": "0xff34", + "To": [ + "65364" + ] + }, + { + "From": "0xff35", + "To": [ + "65365" + ] + }, + { + "From": "0xff36", + "To": [ + "65366" + ] + }, + { + "From": "0xff37", + "To": [ + "65367" + ] + }, + { + "From": "0xff38", + "To": [ + "65368" + ] + }, + { + "From": "0xff39", + "To": [ + "65369" + ] + }, + { + "From": "0xff3a", + "To": [ + "65370" + ] + }, + { + "From": "0x10400", + "To": [ + "66600" + ] + }, + { + "From": "0x10401", + "To": [ + "66601" + ] + }, + { + "From": "0x10402", + "To": [ + "66602" + ] + }, + { + "From": "0x10403", + "To": [ + "66603" + ] + }, + { + "From": "0x10404", + "To": [ + "66604" + ] + }, + { + "From": "0x10405", + "To": [ + "66605" + ] + }, + { + "From": "0x10406", + "To": [ + "66606" + ] + }, + { + "From": "0x10407", + "To": [ + "66607" + ] + }, + { + "From": "0x10408", + "To": [ + "66608" + ] + }, + { + "From": "0x10409", + "To": [ + "66609" + ] + }, + { + "From": "0x1040a", + "To": [ + "66610" + ] + }, + { + "From": "0x1040b", + "To": [ + "66611" + ] + }, + { + "From": "0x1040c", + "To": [ + "66612" + ] + }, + { + "From": "0x1040d", + "To": [ + "66613" + ] + }, + { + "From": "0x1040e", + "To": [ + "66614" + ] + }, + { + "From": "0x1040f", + "To": [ + "66615" + ] + }, + { + "From": "0x10410", + "To": [ + "66616" + ] + }, + { + "From": "0x10411", + "To": [ + "66617" + ] + }, + { + "From": "0x10412", + "To": [ + "66618" + ] + }, + { + "From": "0x10413", + "To": [ + "66619" + ] + }, + { + "From": "0x10414", + "To": [ + "66620" + ] + }, + { + "From": "0x10415", + "To": [ + "66621" + ] + }, + { + "From": "0x10416", + "To": [ + "66622" + ] + }, + { + "From": "0x10417", + "To": [ + "66623" + ] + }, + { + "From": "0x10418", + "To": [ + "66624" + ] + }, + { + "From": "0x10419", + "To": [ + "66625" + ] + }, + { + "From": "0x1041a", + "To": [ + "66626" + ] + }, + { + "From": "0x1041b", + "To": [ + "66627" + ] + }, + { + "From": "0x1041c", + "To": [ + "66628" + ] + }, + { + "From": "0x1041d", + "To": [ + "66629" + ] + }, + { + "From": "0x1041e", + "To": [ + "66630" + ] + }, + { + "From": "0x1041f", + "To": [ + "66631" + ] + }, + { + "From": "0x10420", + "To": [ + "66632" + ] + }, + { + "From": "0x10421", + "To": [ + "66633" + ] + }, + { + "From": "0x10422", + "To": [ + "66634" + ] + }, + { + "From": "0x10423", + "To": [ + "66635" + ] + }, + { + "From": "0x10424", + "To": [ + "66636" + ] + }, + { + "From": "0x10425", + "To": [ + "66637" + ] + }, + { + "From": "0x10426", + "To": [ + "66638" + ] + }, + { + "From": "0x10427", + "To": [ + "66639" + ] + }, + { + "From": "0x104b0", + "To": [ + "66776" + ] + }, + { + "From": "0x104b1", + "To": [ + "66777" + ] + }, + { + "From": "0x104b2", + "To": [ + "66778" + ] + }, + { + "From": "0x104b3", + "To": [ + "66779" + ] + }, + { + "From": "0x104b4", + "To": [ + "66780" + ] + }, + { + "From": "0x104b5", + "To": [ + "66781" + ] + }, + { + "From": "0x104b6", + "To": [ + "66782" + ] + }, + { + "From": "0x104b7", + "To": [ + "66783" + ] + }, + { + "From": "0x104b8", + "To": [ + "66784" + ] + }, + { + "From": "0x104b9", + "To": [ + "66785" + ] + }, + { + "From": "0x104ba", + "To": [ + "66786" + ] + }, + { + "From": "0x104bb", + "To": [ + "66787" + ] + }, + { + "From": "0x104bc", + "To": [ + "66788" + ] + }, + { + "From": "0x104bd", + "To": [ + "66789" + ] + }, + { + "From": "0x104be", + "To": [ + "66790" + ] + }, + { + "From": "0x104bf", + "To": [ + "66791" + ] + }, + { + "From": "0x104c0", + "To": [ + "66792" + ] + }, + { + "From": "0x104c1", + "To": [ + "66793" + ] + }, + { + "From": "0x104c2", + "To": [ + "66794" + ] + }, + { + "From": "0x104c3", + "To": [ + "66795" + ] + }, + { + "From": "0x104c4", + "To": [ + "66796" + ] + }, + { + "From": "0x104c5", + "To": [ + "66797" + ] + }, + { + "From": "0x104c6", + "To": [ + "66798" + ] + }, + { + "From": "0x104c7", + "To": [ + "66799" + ] + }, + { + "From": "0x104c8", + "To": [ + "66800" + ] + }, + { + "From": "0x104c9", + "To": [ + "66801" + ] + }, + { + "From": "0x104ca", + "To": [ + "66802" + ] + }, + { + "From": "0x104cb", + "To": [ + "66803" + ] + }, + { + "From": "0x104cc", + "To": [ + "66804" + ] + }, + { + "From": "0x104cd", + "To": [ + "66805" + ] + }, + { + "From": "0x104ce", + "To": [ + "66806" + ] + }, + { + "From": "0x104cf", + "To": [ + "66807" + ] + }, + { + "From": "0x104d0", + "To": [ + "66808" + ] + }, + { + "From": "0x104d1", + "To": [ + "66809" + ] + }, + { + "From": "0x104d2", + "To": [ + "66810" + ] + }, + { + "From": "0x104d3", + "To": [ + "66811" + ] + }, + { + "From": "0x10570", + "To": [ + "66967" + ] + }, + { + "From": "0x10571", + "To": [ + "66968" + ] + }, + { + "From": "0x10572", + "To": [ + "66969" + ] + }, + { + "From": "0x10573", + "To": [ + "66970" + ] + }, + { + "From": "0x10574", + "To": [ + "66971" + ] + }, + { + "From": "0x10575", + "To": [ + "66972" + ] + }, + { + "From": "0x10576", + "To": [ + "66973" + ] + }, + { + "From": "0x10577", + "To": [ + "66974" + ] + }, + { + "From": "0x10578", + "To": [ + "66975" + ] + }, + { + "From": "0x10579", + "To": [ + "66976" + ] + }, + { + "From": "0x1057a", + "To": [ + "66977" + ] + }, + { + "From": "0x1057c", + "To": [ + "66979" + ] + }, + { + "From": "0x1057d", + "To": [ + "66980" + ] + }, + { + "From": "0x1057e", + "To": [ + "66981" + ] + }, + { + "From": "0x1057f", + "To": [ + "66982" + ] + }, + { + "From": "0x10580", + "To": [ + "66983" + ] + }, + { + "From": "0x10581", + "To": [ + "66984" + ] + }, + { + "From": "0x10582", + "To": [ + "66985" + ] + }, + { + "From": "0x10583", + "To": [ + "66986" + ] + }, + { + "From": "0x10584", + "To": [ + "66987" + ] + }, + { + "From": "0x10585", + "To": [ + "66988" + ] + }, + { + "From": "0x10586", + "To": [ + "66989" + ] + }, + { + "From": "0x10587", + "To": [ + "66990" + ] + }, + { + "From": "0x10588", + "To": [ + "66991" + ] + }, + { + "From": "0x10589", + "To": [ + "66992" + ] + }, + { + "From": "0x1058a", + "To": [ + "66993" + ] + }, + { + "From": "0x1058c", + "To": [ + "66995" + ] + }, + { + "From": "0x1058d", + "To": [ + "66996" + ] + }, + { + "From": "0x1058e", + "To": [ + "66997" + ] + }, + { + "From": "0x1058f", + "To": [ + "66998" + ] + }, + { + "From": "0x10590", + "To": [ + "66999" + ] + }, + { + "From": "0x10591", + "To": [ + "67000" + ] + }, + { + "From": "0x10592", + "To": [ + "67001" + ] + }, + { + "From": "0x10594", + "To": [ + "67003" + ] + }, + { + "From": "0x10595", + "To": [ + "67004" + ] + }, + { + "From": "0x10c80", + "To": [ + "68800" + ] + }, + { + "From": "0x10c81", + "To": [ + "68801" + ] + }, + { + "From": "0x10c82", + "To": [ + "68802" + ] + }, + { + "From": "0x10c83", + "To": [ + "68803" + ] + }, + { + "From": "0x10c84", + "To": [ + "68804" + ] + }, + { + "From": "0x10c85", + "To": [ + "68805" + ] + }, + { + "From": "0x10c86", + "To": [ + "68806" + ] + }, + { + "From": "0x10c87", + "To": [ + "68807" + ] + }, + { + "From": "0x10c88", + "To": [ + "68808" + ] + }, + { + "From": "0x10c89", + "To": [ + "68809" + ] + }, + { + "From": "0x10c8a", + "To": [ + "68810" + ] + }, + { + "From": "0x10c8b", + "To": [ + "68811" + ] + }, + { + "From": "0x10c8c", + "To": [ + "68812" + ] + }, + { + "From": "0x10c8d", + "To": [ + "68813" + ] + }, + { + "From": "0x10c8e", + "To": [ + "68814" + ] + }, + { + "From": "0x10c8f", + "To": [ + "68815" + ] + }, + { + "From": "0x10c90", + "To": [ + "68816" + ] + }, + { + "From": "0x10c91", + "To": [ + "68817" + ] + }, + { + "From": "0x10c92", + "To": [ + "68818" + ] + }, + { + "From": "0x10c93", + "To": [ + "68819" + ] + }, + { + "From": "0x10c94", + "To": [ + "68820" + ] + }, + { + "From": "0x10c95", + "To": [ + "68821" + ] + }, + { + "From": "0x10c96", + "To": [ + "68822" + ] + }, + { + "From": "0x10c97", + "To": [ + "68823" + ] + }, + { + "From": "0x10c98", + "To": [ + "68824" + ] + }, + { + "From": "0x10c99", + "To": [ + "68825" + ] + }, + { + "From": "0x10c9a", + "To": [ + "68826" + ] + }, + { + "From": "0x10c9b", + "To": [ + "68827" + ] + }, + { + "From": "0x10c9c", + "To": [ + "68828" + ] + }, + { + "From": "0x10c9d", + "To": [ + "68829" + ] + }, + { + "From": "0x10c9e", + "To": [ + "68830" + ] + }, + { + "From": "0x10c9f", + "To": [ + "68831" + ] + }, + { + "From": "0x10ca0", + "To": [ + "68832" + ] + }, + { + "From": "0x10ca1", + "To": [ + "68833" + ] + }, + { + "From": "0x10ca2", + "To": [ + "68834" + ] + }, + { + "From": "0x10ca3", + "To": [ + "68835" + ] + }, + { + "From": "0x10ca4", + "To": [ + "68836" + ] + }, + { + "From": "0x10ca5", + "To": [ + "68837" + ] + }, + { + "From": "0x10ca6", + "To": [ + "68838" + ] + }, + { + "From": "0x10ca7", + "To": [ + "68839" + ] + }, + { + "From": "0x10ca8", + "To": [ + "68840" + ] + }, + { + "From": "0x10ca9", + "To": [ + "68841" + ] + }, + { + "From": "0x10caa", + "To": [ + "68842" + ] + }, + { + "From": "0x10cab", + "To": [ + "68843" + ] + }, + { + "From": "0x10cac", + "To": [ + "68844" + ] + }, + { + "From": "0x10cad", + "To": [ + "68845" + ] + }, + { + "From": "0x10cae", + "To": [ + "68846" + ] + }, + { + "From": "0x10caf", + "To": [ + "68847" + ] + }, + { + "From": "0x10cb0", + "To": [ + "68848" + ] + }, + { + "From": "0x10cb1", + "To": [ + "68849" + ] + }, + { + "From": "0x10cb2", + "To": [ + "68850" + ] + }, + { + "From": "0x118a0", + "To": [ + "71872" + ] + }, + { + "From": "0x118a1", + "To": [ + "71873" + ] + }, + { + "From": "0x118a2", + "To": [ + "71874" + ] + }, + { + "From": "0x118a3", + "To": [ + "71875" + ] + }, + { + "From": "0x118a4", + "To": [ + "71876" + ] + }, + { + "From": "0x118a5", + "To": [ + "71877" + ] + }, + { + "From": "0x118a6", + "To": [ + "71878" + ] + }, + { + "From": "0x118a7", + "To": [ + "71879" + ] + }, + { + "From": "0x118a8", + "To": [ + "71880" + ] + }, + { + "From": "0x118a9", + "To": [ + "71881" + ] + }, + { + "From": "0x118aa", + "To": [ + "71882" + ] + }, + { + "From": "0x118ab", + "To": [ + "71883" + ] + }, + { + "From": "0x118ac", + "To": [ + "71884" + ] + }, + { + "From": "0x118ad", + "To": [ + "71885" + ] + }, + { + "From": "0x118ae", + "To": [ + "71886" + ] + }, + { + "From": "0x118af", + "To": [ + "71887" + ] + }, + { + "From": "0x118b0", + "To": [ + "71888" + ] + }, + { + "From": "0x118b1", + "To": [ + "71889" + ] + }, + { + "From": "0x118b2", + "To": [ + "71890" + ] + }, + { + "From": "0x118b3", + "To": [ + "71891" + ] + }, + { + "From": "0x118b4", + "To": [ + "71892" + ] + }, + { + "From": "0x118b5", + "To": [ + "71893" + ] + }, + { + "From": "0x118b6", + "To": [ + "71894" + ] + }, + { + "From": "0x118b7", + "To": [ + "71895" + ] + }, + { + "From": "0x118b8", + "To": [ + "71896" + ] + }, + { + "From": "0x118b9", + "To": [ + "71897" + ] + }, + { + "From": "0x118ba", + "To": [ + "71898" + ] + }, + { + "From": "0x118bb", + "To": [ + "71899" + ] + }, + { + "From": "0x118bc", + "To": [ + "71900" + ] + }, + { + "From": "0x118bd", + "To": [ + "71901" + ] + }, + { + "From": "0x118be", + "To": [ + "71902" + ] + }, + { + "From": "0x118bf", + "To": [ + "71903" + ] + }, + { + "From": "0x16e40", + "To": [ + "93792" + ] + }, + { + "From": "0x16e41", + "To": [ + "93793" + ] + }, + { + "From": "0x16e42", + "To": [ + "93794" + ] + }, + { + "From": "0x16e43", + "To": [ + "93795" + ] + }, + { + "From": "0x16e44", + "To": [ + "93796" + ] + }, + { + "From": "0x16e45", + "To": [ + "93797" + ] + }, + { + "From": "0x16e46", + "To": [ + "93798" + ] + }, + { + "From": "0x16e47", + "To": [ + "93799" + ] + }, + { + "From": "0x16e48", + "To": [ + "93800" + ] + }, + { + "From": "0x16e49", + "To": [ + "93801" + ] + }, + { + "From": "0x16e4a", + "To": [ + "93802" + ] + }, + { + "From": "0x16e4b", + "To": [ + "93803" + ] + }, + { + "From": "0x16e4c", + "To": [ + "93804" + ] + }, + { + "From": "0x16e4d", + "To": [ + "93805" + ] + }, + { + "From": "0x16e4e", + "To": [ + "93806" + ] + }, + { + "From": "0x16e4f", + "To": [ + "93807" + ] + }, + { + "From": "0x16e50", + "To": [ + "93808" + ] + }, + { + "From": "0x16e51", + "To": [ + "93809" + ] + }, + { + "From": "0x16e52", + "To": [ + "93810" + ] + }, + { + "From": "0x16e53", + "To": [ + "93811" + ] + }, + { + "From": "0x16e54", + "To": [ + "93812" + ] + }, + { + "From": "0x16e55", + "To": [ + "93813" + ] + }, + { + "From": "0x16e56", + "To": [ + "93814" + ] + }, + { + "From": "0x16e57", + "To": [ + "93815" + ] + }, + { + "From": "0x16e58", + "To": [ + "93816" + ] + }, + { + "From": "0x16e59", + "To": [ + "93817" + ] + }, + { + "From": "0x16e5a", + "To": [ + "93818" + ] + }, + { + "From": "0x16e5b", + "To": [ + "93819" + ] + }, + { + "From": "0x16e5c", + "To": [ + "93820" + ] + }, + { + "From": "0x16e5d", + "To": [ + "93821" + ] + }, + { + "From": "0x16e5e", + "To": [ + "93822" + ] + }, + { + "From": "0x16e5f", + "To": [ + "93823" + ] + }, + { + "From": "0x1e900", + "To": [ + "125218" + ] + }, + { + "From": "0x1e901", + "To": [ + "125219" + ] + }, + { + "From": "0x1e902", + "To": [ + "125220" + ] + }, + { + "From": "0x1e903", + "To": [ + "125221" + ] + }, + { + "From": "0x1e904", + "To": [ + "125222" + ] + }, + { + "From": "0x1e905", + "To": [ + "125223" + ] + }, + { + "From": "0x1e906", + "To": [ + "125224" + ] + }, + { + "From": "0x1e907", + "To": [ + "125225" + ] + }, + { + "From": "0x1e908", + "To": [ + "125226" + ] + }, + { + "From": "0x1e909", + "To": [ + "125227" + ] + }, + { + "From": "0x1e90a", + "To": [ + "125228" + ] + }, + { + "From": "0x1e90b", + "To": [ + "125229" + ] + }, + { + "From": "0x1e90c", + "To": [ + "125230" + ] + }, + { + "From": "0x1e90d", + "To": [ + "125231" + ] + }, + { + "From": "0x1e90e", + "To": [ + "125232" + ] + }, + { + "From": "0x1e90f", + "To": [ + "125233" + ] + }, + { + "From": "0x1e910", + "To": [ + "125234" + ] + }, + { + "From": "0x1e911", + "To": [ + "125235" + ] + }, + { + "From": "0x1e912", + "To": [ + "125236" + ] + }, + { + "From": "0x1e913", + "To": [ + "125237" + ] + }, + { + "From": "0x1e914", + "To": [ + "125238" + ] + }, + { + "From": "0x1e915", + "To": [ + "125239" + ] + }, + { + "From": "0x1e916", + "To": [ + "125240" + ] + }, + { + "From": "0x1e917", + "To": [ + "125241" + ] + }, + { + "From": "0x1e918", + "To": [ + "125242" + ] + }, + { + "From": "0x1e919", + "To": [ + "125243" + ] + }, + { + "From": "0x1e91a", + "To": [ + "125244" + ] + }, + { + "From": "0x1e91b", + "To": [ + "125245" + ] + }, + { + "From": "0x1e91c", + "To": [ + "125246" + ] + }, + { + "From": "0x1e91d", + "To": [ + "125247" + ] + }, + { + "From": "0x1e91e", + "To": [ + "125248" + ] + }, + { + "From": "0x1e91f", + "To": [ + "125249" + ] + }, + { + "From": "0x1e920", + "To": [ + "125250" + ] + }, + { + "From": "0x1e921", + "To": [ + "125251" + ] + } + ], + "prefix": "unicodeCaseFolding", + "types": { + "From": "rune", + "To": "[]rune" + } +} \ No newline at end of file diff --git a/ast/ast.go b/ast/ast.go new file mode 100644 index 0000000..e4bd205 --- /dev/null +++ b/ast/ast.go @@ -0,0 +1,559 @@ +// Package ast defines AST nodes that represent markdown elements. +package ast + +import ( + "bytes" + "fmt" + "strings" + + textm "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +// A NodeType indicates what type a node belongs to. +type NodeType int + +const ( + // TypeBlock indicates that a node is kind of block nodes. + TypeBlock NodeType = iota + 1 + // TypeInline indicates that a node is kind of inline nodes. + TypeInline + // TypeDocument indicates that a node is kind of document nodes. + TypeDocument +) + +// NodeKind indicates more specific type than NodeType. +type NodeKind int + +func (k NodeKind) String() string { + return kindNames[k] +} + +var kindMax NodeKind +var kindNames = []string{""} + +// NewNodeKind returns a new Kind value. +func NewNodeKind(name string) NodeKind { + kindMax++ + kindNames = append(kindNames, name) + return kindMax +} + +// An Attribute is an attribute of the Node. +type Attribute struct { + Name []byte + Value any +} + +// A Node interface defines basic AST node functionalities. +type Node interface { + // Type returns a type of this node. + Type() NodeType + + // Kind returns a kind of this node. + Kind() NodeKind + + // Pos returns a position of this node in a source. + // If this node position is not defined, Pos returns -1. + Pos() int + + // SetPos sets a position of this node in a source. + // Some node may ignore this method. For example, Paragraph node ignores this method because + // it calculates its position from its lines. + SetPos(v int) + + // NextSibling returns a next sibling node of this node. + NextSibling() Node + + // PreviousSibling returns a previous sibling node of this node. + PreviousSibling() Node + + // Parent returns a parent node of this node. + Parent() Node + + // SetParent sets a parent node to this node. + SetParent(Node) + + // SetPreviousSibling sets a previous sibling node to this node. + SetPreviousSibling(Node) + + // SetNextSibling sets a next sibling node to this node. + SetNextSibling(Node) + + // HasChildren returns true if this node has any children, otherwise false. + HasChildren() bool + + // ChildCount returns a total number of children. + ChildCount() int + + // FirstChild returns a first child of this node. + FirstChild() Node + + // LastChild returns a last child of this node. + LastChild() Node + + // AppendChild append a node child to the tail of the children. + AppendChild(self, child Node) + + // RemoveChild removes a node child from this node. + // If a node child is not children of this node, RemoveChild nothing to do. + RemoveChild(self, child Node) + + // RemoveChildren removes all children from this node. + RemoveChildren(self Node) + + // SortChildren sorts childrens by comparator. + SortChildren(comparator func(n1, n2 Node) int) + + // ReplaceChild replace a node v1 with a node insertee. + // If v1 is not children of this node, ReplaceChild append a insetee to the + // tail of the children. + ReplaceChild(self, v1, insertee Node) + + // InsertBefore inserts a node insertee before a node v1. + // If v1 is not children of this node, InsertBefore append a insetee to the + // tail of the children. + InsertBefore(self, v1, insertee Node) + + // InsertAfterinserts a node insertee after a node v1. + // If v1 is not children of this node, InsertBefore append a insetee to the + // tail of the children. + InsertAfter(self, v1, insertee Node) + + // OwnerDocument returns this node's owner document. + // If this node is not a child of the Document node, OwnerDocument + // returns nil. + OwnerDocument() *Document + + // Dump dumps an AST tree structure to stdout. + // This function completely aimed for debugging. + // level is a indent level. Implementer should indent informations with + // 2 * level spaces. + Dump(source []byte, level int) + + // Text returns text values of this node. + // This method is valid only for some inline nodes. + // If this node is a block node, Text returns a text value as reasonable as possible. + // Notice that there are no 'correct' text values for the block nodes. + // Result for the block nodes may be different from your expectation. + // + // Deprecated: Use other properties of the node to get the text value(i.e. Pragraph.Lines, Text.Value). + Text(source []byte) []byte + + // HasBlankPreviousLines returns true if the row before this node is blank, + // otherwise false. + // This method is valid only for block nodes. + HasBlankPreviousLines() bool + + // SetBlankPreviousLines sets whether the row before this node is blank. + // This method is valid only for block nodes. + SetBlankPreviousLines(v bool) + + // Lines returns text segments that hold positions in a source. + // This method is valid only for block nodes. + Lines() *textm.Segments + + // SetLines sets text segments that hold positions in a source. + // This method is valid only for block nodes. + SetLines(*textm.Segments) + + // IsRaw returns true if contents should be rendered as 'raw' contents. + IsRaw() bool + + // SetAttribute sets the given value to the attributes. + SetAttribute(name []byte, value any) + + // SetAttributeString sets the given value to the attributes. + SetAttributeString(name string, value any) + + // Attribute returns a (attribute value, true) if an attribute + // associated with the given name is found, otherwise + // (nil, false) + Attribute(name []byte) (any, bool) + + // AttributeString returns a (attribute value, true) if an attribute + // associated with the given name is found, otherwise + // (nil, false) + AttributeString(name string) (any, bool) + + // Attributes returns a list of attributes. + // This may be a nil if there are no attributes. + Attributes() []Attribute + + // RemoveAttributes removes all attributes from this node. + RemoveAttributes() +} + +type pos struct { + has bool + value int +} + +func (p *pos) Pos() int { + if p.has { + return p.value + } + return -1 +} + +func (p *pos) SetPos(v int) { + p.has = true + p.value = v +} + +// A BaseNode struct implements the Node interface partialliy. +type BaseNode struct { + firstChild Node + lastChild Node + parent Node + next Node + prev Node + childCount int + attributes []Attribute + pos pos +} + +func ensureIsolated(v Node) { + if p := v.Parent(); p != nil { + p.RemoveChild(p, v) + } +} + +// Pos implements Node.Pos . +func (n *BaseNode) Pos() int { + return n.pos.Pos() +} + +// SetPos implements Node.SetPos . +func (n *BaseNode) SetPos(v int) { + n.pos.SetPos(v) +} + +// HasChildren implements Node.HasChildren . +func (n *BaseNode) HasChildren() bool { + return n.firstChild != nil +} + +// SetPreviousSibling implements Node.SetPreviousSibling . +func (n *BaseNode) SetPreviousSibling(v Node) { + n.prev = v +} + +// SetNextSibling implements Node.SetNextSibling . +func (n *BaseNode) SetNextSibling(v Node) { + n.next = v +} + +// PreviousSibling implements Node.PreviousSibling . +func (n *BaseNode) PreviousSibling() Node { + return n.prev +} + +// NextSibling implements Node.NextSibling . +func (n *BaseNode) NextSibling() Node { + return n.next +} + +// RemoveChild implements Node.RemoveChild . +func (n *BaseNode) RemoveChild(self, v Node) { + if v.Parent() != self { + return + } + n.childCount-- + prev := v.PreviousSibling() + next := v.NextSibling() + if prev != nil { + prev.SetNextSibling(next) + } else { + n.firstChild = next + } + if next != nil { + next.SetPreviousSibling(prev) + } else { + n.lastChild = prev + } + v.SetParent(nil) + v.SetPreviousSibling(nil) + v.SetNextSibling(nil) +} + +// RemoveChildren implements Node.RemoveChildren . +func (n *BaseNode) RemoveChildren(self Node) { + for c := n.firstChild; c != nil; { + c.SetParent(nil) + c.SetPreviousSibling(nil) + next := c.NextSibling() + c.SetNextSibling(nil) + c = next + } + n.firstChild = nil + n.lastChild = nil + n.childCount = 0 +} + +// SortChildren implements Node.SortChildren. +func (n *BaseNode) SortChildren(comparator func(n1, n2 Node) int) { + var sorted Node + current := n.firstChild + for current != nil { + next := current.NextSibling() + if sorted == nil || comparator(sorted, current) >= 0 { + current.SetNextSibling(sorted) + if sorted != nil { + sorted.SetPreviousSibling(current) + } + sorted = current + sorted.SetPreviousSibling(nil) + } else { + c := sorted + for c.NextSibling() != nil && comparator(c.NextSibling(), current) < 0 { + c = c.NextSibling() + } + current.SetNextSibling(c.NextSibling()) + current.SetPreviousSibling(c) + if c.NextSibling() != nil { + c.NextSibling().SetPreviousSibling(current) + } + c.SetNextSibling(current) + } + current = next + } + n.firstChild = sorted + for c := n.firstChild; c != nil; c = c.NextSibling() { + n.lastChild = c + } +} + +// FirstChild implements Node.FirstChild . +func (n *BaseNode) FirstChild() Node { + return n.firstChild +} + +// LastChild implements Node.LastChild . +func (n *BaseNode) LastChild() Node { + return n.lastChild +} + +// ChildCount implements Node.ChildCount . +func (n *BaseNode) ChildCount() int { + return n.childCount +} + +// Parent implements Node.Parent . +func (n *BaseNode) Parent() Node { + return n.parent +} + +// SetParent implements Node.SetParent . +func (n *BaseNode) SetParent(v Node) { + n.parent = v +} + +// AppendChild implements Node.AppendChild . +func (n *BaseNode) AppendChild(self, v Node) { + ensureIsolated(v) + if n.firstChild == nil { + n.firstChild = v + v.SetNextSibling(nil) + v.SetPreviousSibling(nil) + } else { + last := n.lastChild + last.SetNextSibling(v) + v.SetPreviousSibling(last) + } + v.SetParent(self) + n.lastChild = v + n.childCount++ +} + +// ReplaceChild implements Node.ReplaceChild . +func (n *BaseNode) ReplaceChild(self, v1, insertee Node) { + n.InsertBefore(self, v1, insertee) + n.RemoveChild(self, v1) +} + +// InsertAfter implements Node.InsertAfter . +func (n *BaseNode) InsertAfter(self, v1, insertee Node) { + n.InsertBefore(self, v1.NextSibling(), insertee) +} + +// InsertBefore implements Node.InsertBefore . +func (n *BaseNode) InsertBefore(self, v1, insertee Node) { + n.childCount++ + if v1 == nil { + n.AppendChild(self, insertee) + return + } + ensureIsolated(insertee) + if v1.Parent() == self { + c := v1 + prev := c.PreviousSibling() + if prev != nil { + prev.SetNextSibling(insertee) + insertee.SetPreviousSibling(prev) + } else { + n.firstChild = insertee + insertee.SetPreviousSibling(nil) + } + insertee.SetNextSibling(c) + c.SetPreviousSibling(insertee) + insertee.SetParent(self) + } +} + +// OwnerDocument implements Node.OwnerDocument. +func (n *BaseNode) OwnerDocument() *Document { + d := n.Parent() + for { + p := d.Parent() + if p == nil { + if v, ok := d.(*Document); ok { + return v + } + break + } + d = p + } + return nil +} + +// Text implements Node.Text . +// +// Deprecated: Use other properties of the node to get the text value(i.e. Pragraph.Lines, Text.Value). +func (n *BaseNode) Text(source []byte) []byte { + var buf bytes.Buffer + for c := n.firstChild; c != nil; c = c.NextSibling() { + buf.Write(c.Text(source)) + if sb, ok := c.(interface { + SoftLineBreak() bool + }); ok && sb.SoftLineBreak() { + buf.WriteByte('\n') + } + } + return buf.Bytes() +} + +// SetAttribute implements Node.SetAttribute. +func (n *BaseNode) SetAttribute(name []byte, value any) { + if n.attributes == nil { + n.attributes = make([]Attribute, 0, 10) + } else { + for i, a := range n.attributes { + if bytes.Equal(a.Name, name) { + n.attributes[i].Name = name + n.attributes[i].Value = value + return + } + } + } + n.attributes = append(n.attributes, Attribute{name, value}) +} + +// SetAttributeString implements Node.SetAttributeString. +func (n *BaseNode) SetAttributeString(name string, value any) { + n.SetAttribute(util.StringToReadOnlyBytes(name), value) +} + +// Attribute implements Node.Attribute. +func (n *BaseNode) Attribute(name []byte) (any, bool) { + if n.attributes == nil { + return nil, false + } + for i, a := range n.attributes { + if bytes.Equal(a.Name, name) { + return n.attributes[i].Value, true + } + } + return nil, false +} + +// AttributeString implements Node.AttributeString. +func (n *BaseNode) AttributeString(s string) (any, bool) { + return n.Attribute(util.StringToReadOnlyBytes(s)) +} + +// Attributes implements Node.Attributes. +func (n *BaseNode) Attributes() []Attribute { + return n.attributes +} + +// RemoveAttributes implements Node.RemoveAttributes. +func (n *BaseNode) RemoveAttributes() { + n.attributes = nil +} + +// DumpHelper is a helper function to implement Node.Dump. +// kv is pairs of an attribute name and an attribute value. +// cb is a function called after wrote a name and attributes. +func DumpHelper(v Node, source []byte, level int, kv map[string]string, cb func(int)) { + name := v.Kind().String() + indent := strings.Repeat(" ", level) + fmt.Printf("%s%s {\n", indent, name) + indent2 := strings.Repeat(" ", level+1) + fmt.Printf("%sPos: %d\n", indent2, v.Pos()) + if v.Type() == TypeBlock { + fmt.Printf("%sRawText: \"", indent2) + for i := range v.Lines().Len() { + line := v.Lines().At(i) + fmt.Printf("%s", line.Value(source)) + } + fmt.Printf("\"\n") + fmt.Printf("%sHasBlankPreviousLines: %v\n", indent2, v.HasBlankPreviousLines()) + } + for name, value := range kv { + fmt.Printf("%s%s: %s\n", indent2, name, value) + } + if cb != nil { + cb(level + 1) + } + for c := v.FirstChild(); c != nil; c = c.NextSibling() { + c.Dump(source, level+1) + } + fmt.Printf("%s}\n", indent) +} + +// WalkStatus represents a current status of the Walk function. +type WalkStatus int + +const ( + // WalkStop indicates no more walking needed. + WalkStop WalkStatus = iota + 1 + + // WalkSkipChildren indicates that Walk wont walk on children of current + // node. + WalkSkipChildren + + // WalkContinue indicates that Walk can continue to walk. + WalkContinue +) + +// Walker is a function that will be called when Walk find a +// new node. +// entering is set true before walks children, false after walked children. +// If Walker returns error, Walk function immediately stop walking. +type Walker func(n Node, entering bool) (WalkStatus, error) + +// Walk walks a AST tree by the depth first search algorithm. +func Walk(n Node, walker Walker) error { + _, err := walkHelper(n, walker) + return err +} + +func walkHelper(n Node, walker Walker) (WalkStatus, error) { + status, err := walker(n, true) + if err != nil || status == WalkStop { + return status, err + } + if status != WalkSkipChildren { + for c := n.FirstChild(); c != nil; c = c.NextSibling() { + if st, err := walkHelper(c, walker); err != nil || st == WalkStop { + return WalkStop, err + } + } + } + status, err = walker(n, false) + if err != nil || status == WalkStop { + return WalkStop, err + } + return WalkContinue, nil +} diff --git a/ast/ast_test.go b/ast/ast_test.go new file mode 100644 index 0000000..191fffd --- /dev/null +++ b/ast/ast_test.go @@ -0,0 +1,60 @@ +package ast + +import ( + "reflect" + "testing" +) + +func TestWalk(t *testing.T) { + tests := []struct { + name string + node Node + want []NodeKind + action map[NodeKind]WalkStatus + }{ + { + "visits all in depth first order", + node(NewDocument(), node(NewHeading(1), NewText()), NewLink()), + []NodeKind{KindDocument, KindHeading, KindText, KindLink}, + map[NodeKind]WalkStatus{}, + }, + { + "stops after heading", + node(NewDocument(), node(NewHeading(1), NewText()), NewLink()), + []NodeKind{KindDocument, KindHeading}, + map[NodeKind]WalkStatus{KindHeading: WalkStop}, + }, + { + "skip children", + node(NewDocument(), node(NewHeading(1), NewText()), NewLink()), + []NodeKind{KindDocument, KindHeading, KindLink}, + map[NodeKind]WalkStatus{KindHeading: WalkSkipChildren}, + }, + } + for _, tt := range tests { + var kinds []NodeKind + collectKinds := func(n Node, entering bool) (WalkStatus, error) { + if entering { + kinds = append(kinds, n.Kind()) + } + if status, ok := tt.action[n.Kind()]; ok { + return status, nil + } + return WalkContinue, nil + } + t.Run(tt.name, func(t *testing.T) { + if err := Walk(tt.node, collectKinds); err != nil { + t.Errorf("Walk() error = %v", err) + } else if !reflect.DeepEqual(kinds, tt.want) { + t.Errorf("Walk() expected = %v, got = %v", tt.want, kinds) + } + }) + } +} + +func node(n Node, children ...Node) Node { + for _, c := range children { + n.AppendChild(n, c) + } + return n +} diff --git a/ast/block.go b/ast/block.go new file mode 100644 index 0000000..806f99a --- /dev/null +++ b/ast/block.go @@ -0,0 +1,622 @@ +package ast + +import ( + "fmt" + "strings" + + textm "github.com/yuin/goldmark/text" +) + +// A BaseBlock struct implements the Node interface partialliy. +type BaseBlock struct { + BaseNode + lines textm.Segments + blankPreviousLines bool +} + +// Type implements Node.Type. +func (b *BaseBlock) Type() NodeType { + return TypeBlock +} + +// IsRaw implements Node.IsRaw. +func (b *BaseBlock) IsRaw() bool { + return false +} + +// HasBlankPreviousLines implements Node.HasBlankPreviousLines. +func (b *BaseBlock) HasBlankPreviousLines() bool { + return b.blankPreviousLines +} + +// SetBlankPreviousLines implements Node.SetBlankPreviousLines. +func (b *BaseBlock) SetBlankPreviousLines(v bool) { + b.blankPreviousLines = v +} + +// Lines implements Node.Lines. +func (b *BaseBlock) Lines() *textm.Segments { + return &b.lines +} + +// SetLines implements Node.SetLines. +func (b *BaseBlock) SetLines(v *textm.Segments) { + b.lines = *v +} + +// A Document struct is a root node of Markdown text. +type Document struct { + BaseBlock + + meta map[string]any +} + +// KindDocument is a NodeKind of the Document node. +var KindDocument = NewNodeKind("Document") + +// Dump implements Node.Dump . +func (n *Document) Dump(source []byte, level int) { + DumpHelper(n, source, level, nil, nil) +} + +// Type implements Node.Type . +func (n *Document) Type() NodeType { + return TypeDocument +} + +// Pos implements Node.Pos. +func (n *Document) Pos() int { + return 0 +} + +// Kind implements Node.Kind. +func (n *Document) Kind() NodeKind { + return KindDocument +} + +// OwnerDocument implements Node.OwnerDocument. +func (n *Document) OwnerDocument() *Document { + return n +} + +// Meta returns metadata of this document. +func (n *Document) Meta() map[string]any { + if n.meta == nil { + n.meta = map[string]any{} + } + return n.meta +} + +// SetMeta sets given metadata to this document. +func (n *Document) SetMeta(meta map[string]any) { + if n.meta == nil { + n.meta = map[string]any{} + } + for k, v := range meta { + n.meta[k] = v + } +} + +// AddMeta adds given metadata to this document. +func (n *Document) AddMeta(key string, value any) { + if n.meta == nil { + n.meta = map[string]any{} + } + n.meta[key] = value +} + +// NewDocument returns a new Document node. +func NewDocument() *Document { + return &Document{ + BaseBlock: BaseBlock{}, + meta: nil, + } +} + +// A TextBlock struct is a node whose lines +// should be rendered without any containers. +type TextBlock struct { + BaseBlock +} + +// Dump implements Node.Dump . +func (n *TextBlock) Dump(source []byte, level int) { + DumpHelper(n, source, level, nil, nil) +} + +// Pos implements Node.Pos. +func (n *TextBlock) Pos() int { + if n.lines.Len() == 0 { + return -1 + } + return n.lines.At(0).Start +} + +// KindTextBlock is a NodeKind of the TextBlock node. +var KindTextBlock = NewNodeKind("TextBlock") + +// Kind implements Node.Kind. +func (n *TextBlock) Kind() NodeKind { + return KindTextBlock +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. TextBlock.Lines). +func (n *TextBlock) Text(source []byte) []byte { + return n.Lines().Value(source) +} + +// NewTextBlock returns a new TextBlock node. +func NewTextBlock() *TextBlock { + return &TextBlock{ + BaseBlock: BaseBlock{}, + } +} + +// A Paragraph struct represents a paragraph of Markdown text. +type Paragraph struct { + BaseBlock +} + +// Dump implements Node.Dump . +func (n *Paragraph) Dump(source []byte, level int) { + DumpHelper(n, source, level, nil, nil) +} + +// Pos implements Node.Pos. +func (n *Paragraph) Pos() int { + if n.lines.Len() == 0 { + return -1 + } + return n.lines.At(0).Start +} + +// KindParagraph is a NodeKind of the Paragraph node. +var KindParagraph = NewNodeKind("Paragraph") + +// Kind implements Node.Kind. +func (n *Paragraph) Kind() NodeKind { + return KindParagraph +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. Paragraph.Lines). +func (n *Paragraph) Text(source []byte) []byte { + return n.Lines().Value(source) +} + +// NewParagraph returns a new Paragraph node. +func NewParagraph() *Paragraph { + return &Paragraph{ + BaseBlock: BaseBlock{}, + } +} + +// IsParagraph returns true if the given node implements the Paragraph interface, +// otherwise false. +func IsParagraph(node Node) bool { + _, ok := node.(*Paragraph) + return ok +} + +// A Heading struct represents headings like SetextHeading and ATXHeading. +type Heading struct { + BaseBlock + // Level returns a level of this heading. + // This value is between 1 and 6. + Level int +} + +// Dump implements Node.Dump . +func (n *Heading) Dump(source []byte, level int) { + m := map[string]string{ + "Level": fmt.Sprintf("%d", n.Level), + } + DumpHelper(n, source, level, m, nil) +} + +// KindHeading is a NodeKind of the Heading node. +var KindHeading = NewNodeKind("Heading") + +// Kind implements Node.Kind. +func (n *Heading) Kind() NodeKind { + return KindHeading +} + +// NewHeading returns a new Heading node. +func NewHeading(level int) *Heading { + return &Heading{ + BaseBlock: BaseBlock{}, + Level: level, + } +} + +// A ThematicBreak struct represents a thematic break of Markdown text. +type ThematicBreak struct { + BaseBlock +} + +// Dump implements Node.Dump . +func (n *ThematicBreak) Dump(source []byte, level int) { + DumpHelper(n, source, level, nil, nil) +} + +// KindThematicBreak is a NodeKind of the ThematicBreak node. +var KindThematicBreak = NewNodeKind("ThematicBreak") + +// Kind implements Node.Kind. +func (n *ThematicBreak) Kind() NodeKind { + return KindThematicBreak +} + +// NewThematicBreak returns a new ThematicBreak node. +func NewThematicBreak() *ThematicBreak { + return &ThematicBreak{ + BaseBlock: BaseBlock{}, + } +} + +// A CodeBlock interface represents an indented code block of Markdown text. +type CodeBlock struct { + BaseBlock +} + +// IsRaw implements Node.IsRaw. +func (n *CodeBlock) IsRaw() bool { + return true +} + +// Dump implements Node.Dump . +func (n *CodeBlock) Dump(source []byte, level int) { + DumpHelper(n, source, level, nil, nil) +} + +// KindCodeBlock is a NodeKind of the CodeBlock node. +var KindCodeBlock = NewNodeKind("CodeBlock") + +// Kind implements Node.Kind. +func (n *CodeBlock) Kind() NodeKind { + return KindCodeBlock +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. CodeBlock.Lines). +func (n *CodeBlock) Text(source []byte) []byte { + return n.Lines().Value(source) +} + +// NewCodeBlock returns a new CodeBlock node. +func NewCodeBlock() *CodeBlock { + return &CodeBlock{ + BaseBlock: BaseBlock{}, + } +} + +// A FencedCodeBlock struct represents a fenced code block of Markdown text. +type FencedCodeBlock struct { + BaseBlock + // Info returns a info text of this fenced code block. + Info *Text + + language []byte +} + +// Language returns an language in an info string. +// Language returns nil if this node does not have an info string. +func (n *FencedCodeBlock) Language(source []byte) []byte { + if n.language == nil && n.Info != nil { + segment := n.Info.Segment + info := segment.Value(source) + i := 0 + for ; i < len(info); i++ { + if info[i] == ' ' { + break + } + } + n.language = info[:i] + } + return n.language +} + +// IsRaw implements Node.IsRaw. +func (n *FencedCodeBlock) IsRaw() bool { + return true +} + +// Dump implements Node.Dump . +func (n *FencedCodeBlock) Dump(source []byte, level int) { + m := map[string]string{} + if n.Info != nil { + m["Info"] = fmt.Sprintf("\"%s\"", n.Info.Text(source)) + } + DumpHelper(n, source, level, m, nil) +} + +// KindFencedCodeBlock is a NodeKind of the FencedCodeBlock node. +var KindFencedCodeBlock = NewNodeKind("FencedCodeBlock") + +// Kind implements Node.Kind. +func (n *FencedCodeBlock) Kind() NodeKind { + return KindFencedCodeBlock +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. FencedCodeBlock.Lines). +func (n *FencedCodeBlock) Text(source []byte) []byte { + return n.Lines().Value(source) +} + +// NewFencedCodeBlock return a new FencedCodeBlock node. +func NewFencedCodeBlock(info *Text) *FencedCodeBlock { + return &FencedCodeBlock{ + BaseBlock: BaseBlock{}, + Info: info, + } +} + +// A Blockquote struct represents an blockquote block of Markdown text. +type Blockquote struct { + BaseBlock +} + +// Dump implements Node.Dump . +func (n *Blockquote) Dump(source []byte, level int) { + DumpHelper(n, source, level, nil, nil) +} + +// KindBlockquote is a NodeKind of the Blockquote node. +var KindBlockquote = NewNodeKind("Blockquote") + +// Kind implements Node.Kind. +func (n *Blockquote) Kind() NodeKind { + return KindBlockquote +} + +// NewBlockquote returns a new Blockquote node. +func NewBlockquote() *Blockquote { + return &Blockquote{ + BaseBlock: BaseBlock{}, + } +} + +// A List struct represents a list of Markdown text. +type List struct { + BaseBlock + + // Marker is a marker character like '-', '+', ')' and '.'. + Marker byte + + // IsTight is a true if this list is a 'tight' list. + // See https://spec.commonmark.org/0.30/#loose for details. + IsTight bool + + // Start is an initial number of this ordered list. + // If this list is not an ordered list, Start is 0. + Start int +} + +// IsOrdered returns true if this list is an ordered list, otherwise false. +func (l *List) IsOrdered() bool { + return l.Marker == '.' || l.Marker == ')' +} + +// CanContinue returns true if this list can continue with +// the given mark and a list type, otherwise false. +func (l *List) CanContinue(marker byte, isOrdered bool) bool { + return marker == l.Marker && isOrdered == l.IsOrdered() +} + +// Dump implements Node.Dump. +func (l *List) Dump(source []byte, level int) { + m := map[string]string{ + "Ordered": fmt.Sprintf("%v", l.IsOrdered()), + "Marker": fmt.Sprintf("%c", l.Marker), + "Tight": fmt.Sprintf("%v", l.IsTight), + } + if l.IsOrdered() { + m["Start"] = fmt.Sprintf("%d", l.Start) + } + DumpHelper(l, source, level, m, nil) +} + +// KindList is a NodeKind of the List node. +var KindList = NewNodeKind("List") + +// Kind implements Node.Kind. +func (l *List) Kind() NodeKind { + return KindList +} + +// NewList returns a new List node. +func NewList(marker byte) *List { + return &List{ + BaseBlock: BaseBlock{}, + Marker: marker, + IsTight: true, + } +} + +// A ListItem struct represents a list item of Markdown text. +type ListItem struct { + BaseBlock + + // Offset is an offset position of this item. + Offset int +} + +// Dump implements Node.Dump. +func (n *ListItem) Dump(source []byte, level int) { + m := map[string]string{ + "Offset": fmt.Sprintf("%d", n.Offset), + } + DumpHelper(n, source, level, m, nil) +} + +// KindListItem is a NodeKind of the ListItem node. +var KindListItem = NewNodeKind("ListItem") + +// Kind implements Node.Kind. +func (n *ListItem) Kind() NodeKind { + return KindListItem +} + +// NewListItem returns a new ListItem node. +func NewListItem(offset int) *ListItem { + return &ListItem{ + BaseBlock: BaseBlock{}, + Offset: offset, + } +} + +// HTMLBlockType represents kinds of an html blocks. +// See https://spec.commonmark.org/0.30/#html-blocks +type HTMLBlockType int + +const ( + // HTMLBlockType1 represents type 1 html blocks. + HTMLBlockType1 HTMLBlockType = iota + 1 + // HTMLBlockType2 represents type 2 html blocks. + HTMLBlockType2 + // HTMLBlockType3 represents type 3 html blocks. + HTMLBlockType3 + // HTMLBlockType4 represents type 4 html blocks. + HTMLBlockType4 + // HTMLBlockType5 represents type 5 html blocks. + HTMLBlockType5 + // HTMLBlockType6 represents type 6 html blocks. + HTMLBlockType6 + // HTMLBlockType7 represents type 7 html blocks. + HTMLBlockType7 +) + +// An HTMLBlock struct represents an html block of Markdown text. +type HTMLBlock struct { + BaseBlock + + // Type is a type of this html block. + HTMLBlockType HTMLBlockType + + // ClosureLine is a line that closes this html block. + ClosureLine textm.Segment +} + +// IsRaw implements Node.IsRaw. +func (n *HTMLBlock) IsRaw() bool { + return true +} + +// HasClosure returns true if this html block has a closure line, +// otherwise false. +func (n *HTMLBlock) HasClosure() bool { + return n.ClosureLine.Start >= 0 +} + +// Dump implements Node.Dump. +func (n *HTMLBlock) Dump(source []byte, level int) { + indent := strings.Repeat(" ", level) + fmt.Printf("%s%s {\n", indent, "HTMLBlock") + indent2 := strings.Repeat(" ", level+1) + fmt.Printf("%sPos: %d\n", indent2, n.Pos()) + fmt.Printf("%sRawText: \"", indent2) + for i := range n.Lines().Len() { + s := n.Lines().At(i) + fmt.Print(string(source[s.Start:s.Stop])) + } + fmt.Printf("\"\n") + for c := n.FirstChild(); c != nil; c = c.NextSibling() { + c.Dump(source, level+1) + } + if n.HasClosure() { + cl := n.ClosureLine + fmt.Printf("%sClosure: \"%s\"\n", indent2, string(cl.Value(source))) + } + fmt.Printf("%sHasBlankPreviousLines: %v\n", indent2, n.HasBlankPreviousLines()) + fmt.Printf("%s}\n", indent) +} + +// KindHTMLBlock is a NodeKind of the HTMLBlock node. +var KindHTMLBlock = NewNodeKind("HTMLBlock") + +// Kind implements Node.Kind. +func (n *HTMLBlock) Kind() NodeKind { + return KindHTMLBlock +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. HTMLBlock.Lines). +func (n *HTMLBlock) Text(source []byte) []byte { + ret := n.Lines().Value(source) + if n.HasClosure() { + ret = append(ret, n.ClosureLine.Value(source)...) + } + return ret +} + +// NewHTMLBlock returns a new HTMLBlock node. +func NewHTMLBlock(typ HTMLBlockType) *HTMLBlock { + return &HTMLBlock{ + BaseBlock: BaseBlock{}, + HTMLBlockType: typ, + ClosureLine: textm.NewSegment(-1, -1), + } +} + +// A LinkReferenceDefinition struct represents a list of Markdown text. +type LinkReferenceDefinition struct { + BaseBlock + + // Label is a label of this link reference definition. + Label []byte + + // Destination is a destination of this link reference definition. + Destination []byte + + // Title is a title of this link reference definition. + Title []byte +} + +// IsRaw implements Node.IsRaw. +func (l *LinkReferenceDefinition) IsRaw() bool { + return true +} + +// Pos implements Node.Pos. +func (l *LinkReferenceDefinition) Pos() int { + if l.lines.Len() == 0 { + return -1 + } + return l.lines.At(0).Start +} + +// Dump implements Node.Dump. +func (l *LinkReferenceDefinition) Dump(source []byte, level int) { + m := map[string]string{ + "Label": string(l.Label), + "Destination": string(l.Destination), + "Title": string(l.Title), + } + DumpHelper(l, source, level, m, nil) +} + +// KindLinkReferenceDefinition is a NodeKind of the LinkReferenceDefinition node. +var KindLinkReferenceDefinition = NewNodeKind("LinkReferenceDefinition") + +// Kind implements Node.Kind. +func (l *LinkReferenceDefinition) Kind() NodeKind { + return KindLinkReferenceDefinition +} + +// NewLinkReferenceDefinition returns a new LinkReferenceDefinition node. +func NewLinkReferenceDefinition(label, destination, title []byte) *LinkReferenceDefinition { + return &LinkReferenceDefinition{ + BaseBlock: BaseBlock{}, + Label: label, + Destination: destination, + Title: title, + } +} diff --git a/ast/inline.go b/ast/inline.go new file mode 100644 index 0000000..732329c --- /dev/null +++ b/ast/inline.go @@ -0,0 +1,663 @@ +package ast + +import ( + "fmt" + "strings" + + textm "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +// A BaseInline struct implements the Node interface partialliy. +type BaseInline struct { + BaseNode +} + +// Type implements Node.Type. +func (b *BaseInline) Type() NodeType { + return TypeInline +} + +// IsRaw implements Node.IsRaw. +func (b *BaseInline) IsRaw() bool { + return false +} + +// HasBlankPreviousLines implements Node.HasBlankPreviousLines. +func (b *BaseInline) HasBlankPreviousLines() bool { + panic("can not call with inline nodes.") +} + +// SetBlankPreviousLines implements Node.SetBlankPreviousLines. +func (b *BaseInline) SetBlankPreviousLines(v bool) { + panic("can not call with inline nodes.") +} + +// Lines implements Node.Lines. +func (b *BaseInline) Lines() *textm.Segments { + panic("can not call with inline nodes.") +} + +// SetLines implements Node.SetLines. +func (b *BaseInline) SetLines(v *textm.Segments) { + panic("can not call with inline nodes.") +} + +// A Text struct represents a textual content of the Markdown text. +type Text struct { + BaseInline + // Segment is a position in a source text. + Segment textm.Segment + + flags uint8 +} + +const ( + textSoftLineBreak = 1 << iota + textHardLineBreak + textRaw + textCode +) + +func textFlagsString(flags uint8) string { + buf := []string{} + if flags&textSoftLineBreak != 0 { + buf = append(buf, "SoftLineBreak") + } + if flags&textHardLineBreak != 0 { + buf = append(buf, "HardLineBreak") + } + if flags&textRaw != 0 { + buf = append(buf, "Raw") + } + if flags&textCode != 0 { + buf = append(buf, "Code") + } + return strings.Join(buf, ", ") +} + +// Inline implements Inline.Inline. +func (n *Text) Inline() { +} + +// Pos implements Node.Pos. +func (n *Text) Pos() int { + return n.Segment.Start +} + +// SoftLineBreak returns true if this node ends with a new line, +// otherwise false. +func (n *Text) SoftLineBreak() bool { + return n.flags&textSoftLineBreak != 0 +} + +// SetSoftLineBreak sets whether this node ends with a new line. +func (n *Text) SetSoftLineBreak(v bool) { + if v { + n.flags |= textSoftLineBreak + } else { + n.flags = n.flags &^ textSoftLineBreak + } +} + +// IsRaw returns true if this text should be rendered without unescaping +// back slash escapes and resolving references. +func (n *Text) IsRaw() bool { + return n.flags&textRaw != 0 +} + +// SetRaw sets whether this text should be rendered as raw contents. +func (n *Text) SetRaw(v bool) { + if v { + n.flags |= textRaw + } else { + n.flags = n.flags &^ textRaw + } +} + +// HardLineBreak returns true if this node ends with a hard line break. +// See https://spec.commonmark.org/0.30/#hard-line-breaks for details. +func (n *Text) HardLineBreak() bool { + return n.flags&textHardLineBreak != 0 +} + +// SetHardLineBreak sets whether this node ends with a hard line break. +func (n *Text) SetHardLineBreak(v bool) { + if v { + n.flags |= textHardLineBreak + } else { + n.flags = n.flags &^ textHardLineBreak + } +} + +// Merge merges a Node n into this node. +// Merge returns true if the given node has been merged, otherwise false. +func (n *Text) Merge(node Node, source []byte) bool { + t, ok := node.(*Text) + if !ok { + return false + } + if n.Segment.Stop != t.Segment.Start || t.Segment.Padding != 0 || + source[n.Segment.Stop-1] == '\n' || t.IsRaw() != n.IsRaw() { + return false + } + n.Segment.Stop = t.Segment.Stop + n.SetSoftLineBreak(t.SoftLineBreak()) + n.SetHardLineBreak(t.HardLineBreak()) + return true +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. Text.Value). +func (n *Text) Text(source []byte) []byte { + return n.Segment.Value(source) +} + +// Value returns a value of this node. +// SoftLineBreaks are not included in the returned value. +func (n *Text) Value(source []byte) []byte { + return n.Segment.Value(source) +} + +// Dump implements Node.Dump. +func (n *Text) Dump(source []byte, level int) { + m := map[string]string{ + "Value": "\"" + strings.TrimRight(string(n.Value(source)), "\n") + "\"", + } + fs := textFlagsString(n.flags) + if len(fs) != 0 { + m["Flags"] = fs + } + DumpHelper(n, source, level, m, nil) +} + +// KindText is a NodeKind of the Text node. +var KindText = NewNodeKind("Text") + +// Kind implements Node.Kind. +func (n *Text) Kind() NodeKind { + return KindText +} + +// NewText returns a new Text node. +func NewText() *Text { + return &Text{ + BaseInline: BaseInline{}, + } +} + +// NewTextSegment returns a new Text node with the given source position. +func NewTextSegment(v textm.Segment) *Text { + return &Text{ + BaseInline: BaseInline{}, + Segment: v, + } +} + +// NewRawTextSegment returns a new Text node with the given source position. +// The new node should be rendered as raw contents. +func NewRawTextSegment(v textm.Segment) *Text { + t := &Text{ + BaseInline: BaseInline{}, + Segment: v, + } + t.SetRaw(true) + return t +} + +// MergeOrAppendTextSegment merges a given s into the last child of the parent if +// it can be merged, otherwise creates a new Text node and appends it to after current +// last child. +func MergeOrAppendTextSegment(parent Node, s textm.Segment) { + last := parent.LastChild() + t, ok := last.(*Text) + if ok && t.Segment.Stop == s.Start && !t.SoftLineBreak() { + t.Segment = t.Segment.WithStop(s.Stop) + } else { + parent.AppendChild(parent, NewTextSegment(s)) + } +} + +// MergeOrReplaceTextSegment merges a given s into a previous sibling of the node n +// if a previous sibling of the node n is *Text, otherwise replaces Node n with s. +func MergeOrReplaceTextSegment(parent Node, n Node, s textm.Segment) { + prev := n.PreviousSibling() + if t, ok := prev.(*Text); ok && t.Segment.Stop == s.Start && !t.SoftLineBreak() { + t.Segment = t.Segment.WithStop(s.Stop) + parent.RemoveChild(parent, n) + } else { + parent.ReplaceChild(parent, n, NewTextSegment(s)) + } +} + +// A String struct is a textual content that has a concrete value. +type String struct { + BaseInline + + Value []byte + flags uint8 +} + +// Inline implements Inline.Inline. +func (n *String) Inline() { +} + +// Pos implements Node.Pos. +// String node does not have a position because it is not associated with a source text. +func (n *String) Pos() int { + return -1 +} + +// IsRaw returns true if this text should be rendered without unescaping +// back slash escapes and resolving references. +func (n *String) IsRaw() bool { + return n.flags&textRaw != 0 +} + +// SetRaw sets whether this text should be rendered as raw contents. +func (n *String) SetRaw(v bool) { + if v { + n.flags |= textRaw + } else { + n.flags = n.flags &^ textRaw + } +} + +// IsCode returns true if this text should be rendered without any +// modifications. +func (n *String) IsCode() bool { + return n.flags&textCode != 0 +} + +// SetCode sets whether this text should be rendered without any modifications. +func (n *String) SetCode(v bool) { + if v { + n.flags |= textCode + } else { + n.flags = n.flags &^ textCode + } +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. String.Value). +func (n *String) Text(source []byte) []byte { + return n.Value +} + +// Dump implements Node.Dump. +func (n *String) Dump(source []byte, level int) { + fs := textFlagsString(n.flags) + if len(fs) != 0 { + fs = "(" + fs + ")" + } + fmt.Printf("%sString%s: \"%s\"\n", strings.Repeat(" ", level), fs, strings.TrimRight(string(n.Value), "\n")) +} + +// KindString is a NodeKind of the String node. +var KindString = NewNodeKind("String") + +// Kind implements Node.Kind. +func (n *String) Kind() NodeKind { + return KindString +} + +// NewString returns a new String node. +func NewString(v []byte) *String { + return &String{ + Value: v, + } +} + +// A CodeSpan struct represents a code span of Markdown text. +type CodeSpan struct { + BaseInline +} + +// Inline implements Inline.Inline . +func (n *CodeSpan) Inline() { +} + +// IsBlank returns true if this node consists of spaces, otherwise false. +func (n *CodeSpan) IsBlank(source []byte) bool { + for c := n.FirstChild(); c != nil; c = c.NextSibling() { + text := c.(*Text).Segment + if !util.IsBlank(text.Value(source)) { + return false + } + } + return true +} + +// Dump implements Node.Dump. +func (n *CodeSpan) Dump(source []byte, level int) { + DumpHelper(n, source, level, nil, nil) +} + +// KindCodeSpan is a NodeKind of the CodeSpan node. +var KindCodeSpan = NewNodeKind("CodeSpan") + +// Kind implements Node.Kind. +func (n *CodeSpan) Kind() NodeKind { + return KindCodeSpan +} + +// NewCodeSpan returns a new CodeSpan node. +func NewCodeSpan() *CodeSpan { + return &CodeSpan{ + BaseInline: BaseInline{}, + } +} + +// An Emphasis struct represents an emphasis of Markdown text. +type Emphasis struct { + BaseInline + + // Level is a level of the emphasis. + Level int +} + +// Dump implements Node.Dump. +func (n *Emphasis) Dump(source []byte, level int) { + m := map[string]string{ + "Level": fmt.Sprintf("%v", n.Level), + } + DumpHelper(n, source, level, m, nil) +} + +// KindEmphasis is a NodeKind of the Emphasis node. +var KindEmphasis = NewNodeKind("Emphasis") + +// Kind implements Node.Kind. +func (n *Emphasis) Kind() NodeKind { + return KindEmphasis +} + +// NewEmphasis returns a new Emphasis node with the given level. +func NewEmphasis(level int) *Emphasis { + return &Emphasis{ + BaseInline: BaseInline{}, + Level: level, + } +} + +type baseLink struct { + BaseInline + + // Destination is a destination(URL) of this link. + Destination []byte + + // Title is a title of this link. + Title []byte + + // Reference is a reference of this link. This field is used for reference links. + // If this link is not a reference link, this field is nil. + Reference *ReferenceLink +} + +// Inline implements Inline.Inline. +func (n *baseLink) Inline() { +} + +// ReferenceLinkType defines a kind of reference link. +type ReferenceLinkType int + +const ( + // ReferenceLinkFull indicates that a reference link has a full reference like [foo][bar]. + ReferenceLinkFull ReferenceLinkType = iota + 1 + // ReferenceLinkCollapsed indicates that a reference link has a collapsed reference like [foo][]. + ReferenceLinkCollapsed + // ReferenceLinkShortcut indicates that a reference link has a shortcut reference like [foo]. + ReferenceLinkShortcut +) + +// String returns a string representation of this reference link type. +func (t ReferenceLinkType) String() string { + switch t { + case ReferenceLinkFull: + return "Full" + case ReferenceLinkCollapsed: + return "Collapsed" + case ReferenceLinkShortcut: + return "Shortcut" + default: + return fmt.Sprintf("Unknown(%d)", t) + } +} + +// ReferenceLink struct represents a reference link of the Markdown text. +type ReferenceLink struct { + // Type is a kind of this reference link. + Type ReferenceLinkType + + // Value is a value of this reference link. + Value []byte +} + +// NewReferenceLink returns a new ReferenceLink with the given type and value. +func NewReferenceLink(typ ReferenceLinkType, value []byte) *ReferenceLink { + return &ReferenceLink{ + Type: typ, + Value: value, + } +} + +// A Link struct represents a link of the Markdown text. +type Link struct { + baseLink +} + +// Dump implements Node.Dump. +func (n *Link) Dump(source []byte, level int) { + m := map[string]string{} + m["Destination"] = string(n.Destination) + if len(n.Title) != 0 { + m["Title"] = string(n.Title) + } + cb := func(int) {} + if n.Reference != nil { + cb = func(level int) { + indent := strings.Repeat(" ", level) + fmt.Printf("%sReference {\n", indent) + indent2 := strings.Repeat(" ", level+1) + fmt.Printf("%sType : %s\n", indent2, n.Reference.Type.String()) + fmt.Printf("%sValue : %s\n", indent2, string(n.Reference.Value)) + fmt.Printf("%s}\n", indent) + + } + } + DumpHelper(n, source, level, m, cb) +} + +// KindLink is a NodeKind of the Link node. +var KindLink = NewNodeKind("Link") + +// Kind implements Node.Kind. +func (n *Link) Kind() NodeKind { + return KindLink +} + +// NewLink returns a new Link node. +func NewLink() *Link { + c := &Link{ + baseLink: baseLink{ + BaseInline: BaseInline{}, + }, + } + return c +} + +// An Image struct represents an image of the Markdown text. +type Image struct { + baseLink +} + +// Dump implements Node.Dump. +func (n *Image) Dump(source []byte, level int) { + m := map[string]string{} + m["Destination"] = string(n.Destination) + if len(n.Title) != 0 { + m["Title"] = string(n.Title) + } + cb := func(int) {} + if n.Reference != nil { + cb = func(level int) { + indent := strings.Repeat(" ", level) + fmt.Printf("%sReference {\n", indent) + indent2 := strings.Repeat(" ", level+1) + fmt.Printf("%sType : %s\n", indent2, n.Reference.Type.String()) + fmt.Printf("%sValue : %s\n", indent2, string(n.Reference.Value)) + fmt.Printf("%s}\n", indent) + + } + } + DumpHelper(n, source, level, m, cb) +} + +// KindImage is a NodeKind of the Image node. +var KindImage = NewNodeKind("Image") + +// Kind implements Node.Kind. +func (n *Image) Kind() NodeKind { + return KindImage +} + +// NewImage returns a new Image node. +func NewImage(link *Link) *Image { + c := &Image{ + baseLink: baseLink{ + BaseInline: BaseInline{}, + }, + } + c.Destination = link.Destination + c.Title = link.Title + c.Reference = link.Reference + for n := link.FirstChild(); n != nil; { + next := n.NextSibling() + link.RemoveChild(link, n) + c.AppendChild(c, n) + n = next + } + + return c +} + +// AutoLinkType defines kind of auto links. +type AutoLinkType int + +const ( + // AutoLinkEmail indicates that an autolink is an email address. + AutoLinkEmail AutoLinkType = iota + 1 + // AutoLinkURL indicates that an autolink is a generic URL. + AutoLinkURL +) + +// An AutoLink struct represents an autolink of the Markdown text. +type AutoLink struct { + BaseInline + // Type is a type of this autolink. + AutoLinkType AutoLinkType + + // Protocol specified a protocol of the link. + Protocol []byte + + value *Text +} + +// Inline implements Inline.Inline. +func (n *AutoLink) Inline() {} + +// Dump implements Node.Dump. +func (n *AutoLink) Dump(source []byte, level int) { + segment := n.value.Segment + m := map[string]string{ + "Value": string(segment.Value(source)), + } + DumpHelper(n, source, level, m, nil) +} + +// KindAutoLink is a NodeKind of the AutoLink node. +var KindAutoLink = NewNodeKind("AutoLink") + +// Kind implements Node.Kind. +func (n *AutoLink) Kind() NodeKind { + return KindAutoLink +} + +// URL returns an url of this node. +func (n *AutoLink) URL(source []byte) []byte { + if n.Protocol != nil { + s := n.value.Segment + ret := make([]byte, 0, len(n.Protocol)+s.Len()+3) + ret = append(ret, n.Protocol...) + ret = append(ret, ':', '/', '/') + ret = append(ret, n.value.Value(source)...) + return ret + } + return n.value.Value(source) +} + +// Label returns a label of this node. +func (n *AutoLink) Label(source []byte) []byte { + return n.value.Value(source) +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. AutoLink.Label). +func (n *AutoLink) Text(source []byte) []byte { + return n.value.Value(source) +} + +// NewAutoLink returns a new AutoLink node. +func NewAutoLink(typ AutoLinkType, value *Text) *AutoLink { + return &AutoLink{ + BaseInline: BaseInline{}, + value: value, + AutoLinkType: typ, + } +} + +// A RawHTML struct represents an inline raw HTML of the Markdown text. +type RawHTML struct { + BaseInline + Segments *textm.Segments +} + +// Inline implements Inline.Inline. +func (n *RawHTML) Inline() {} + +// Dump implements Node.Dump. +func (n *RawHTML) Dump(source []byte, level int) { + m := map[string]string{} + t := []string{} + for i := range n.Segments.Len() { + segment := n.Segments.At(i) + t = append(t, string(segment.Value(source))) + } + m["RawText"] = strings.Join(t, "") + DumpHelper(n, source, level, m, nil) +} + +// KindRawHTML is a NodeKind of the RawHTML node. +var KindRawHTML = NewNodeKind("RawHTML") + +// Kind implements Node.Kind. +func (n *RawHTML) Kind() NodeKind { + return KindRawHTML +} + +// Text implements Node.Text. +// +// Deprecated: Use other properties of the node to get the text value(i.e. RawHTML.Segments). +func (n *RawHTML) Text(source []byte) []byte { + return n.Segments.Value(source) +} + +// NewRawHTML returns a new RawHTML node. +func NewRawHTML() *RawHTML { + return &RawHTML{ + Segments: textm.NewSegments(), + } +} diff --git a/ast_test.go b/ast_test.go new file mode 100644 index 0000000..f742216 --- /dev/null +++ b/ast_test.go @@ -0,0 +1,336 @@ +package goldmark_test + +import ( + "bytes" + "testing" + + . "github.com/yuin/goldmark" + "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/testutil" + "github.com/yuin/goldmark/text" +) + +func TestASTBlockNodeText(t *testing.T) { + var cases = []struct { + Name string + Source string + T1 string + T2 string + C bool + }{ + { + Name: "AtxHeading", + Source: `# l1 + +a + +# l2`, + T1: `l1`, + T2: `l2`, + }, + { + Name: "SetextHeading", + Source: `l1 +l2 +=============== + +a + +l3 +l4 +==============`, + T1: `l1 +l2`, + T2: `l3 +l4`, + }, + { + Name: "CodeBlock", + Source: ` l1 + l2 + +a + + l3 + l4`, + T1: `l1 +l2 +`, + T2: `l3 +l4 +`, + }, + { + Name: "FencedCodeBlock", + Source: "```" + ` +l1 +l2 +` + "```" + ` + +a + +` + "```" + ` +l3 +l4`, + T1: `l1 +l2 +`, + T2: `l3 +l4 +`, + }, + { + Name: "Blockquote", + Source: `> l1 +> l2 + +a + +> l3 +> l4`, + T1: `l1 +l2`, + T2: `l3 +l4`, + }, + { + Name: "List", + Source: `- l1 + l2 + +a + +- l3 + l4`, + T1: `l1 +l2`, + T2: `l3 +l4`, + C: true, + }, + { + Name: "HTMLBlock", + Source: `
+l1 +l2 +
+ +a + +
+l3 +l4`, + T1: `
+l1 +l2 +
+`, + T2: `
+l3 +l4`, + }, + } + + for _, cs := range cases { + t.Run(cs.Name, func(t *testing.T) { + s := []byte(cs.Source) + md := New() + n := md.Parser().Parse(text.NewReader(s)) + c1 := n.FirstChild() + c2 := c1.NextSibling().NextSibling() + if cs.C { + c1 = c1.FirstChild() + c2 = c2.FirstChild() + } + if !bytes.Equal(c1.Text(s), []byte(cs.T1)) { // nolint: staticcheck + + t.Errorf("%s unmatch: %s", cs.Name, testutil.DiffPretty(c1.Text(s), []byte(cs.T1))) // nolint: staticcheck + + } + if !bytes.Equal(c2.Text(s), []byte(cs.T2)) { // nolint: staticcheck + + t.Errorf("%s(EOF) unmatch: %s", cs.Name, testutil.DiffPretty(c2.Text(s), []byte(cs.T2))) // nolint: staticcheck + + } + }) + } + +} + +func TestASTInlineNodeText(t *testing.T) { + var cases = []struct { + Name string + Source string + T1 string + }{ + { + Name: "CodeSpan", + Source: "`c1`", + T1: `c1`, + }, + { + Name: "Emphasis", + Source: `*c1 **c2***`, + T1: `c1 c2`, + }, + { + Name: "Link", + Source: `[label](url)`, + T1: `label`, + }, + { + Name: "AutoLink", + Source: ``, + T1: `http://url`, + }, + { + Name: "RawHTML", + Source: `c1`, + T1: ``, + }, + } + + for _, cs := range cases { + t.Run(cs.Name, func(t *testing.T) { + s := []byte(cs.Source) + md := New() + n := md.Parser().Parse(text.NewReader(s)) + c1 := n.FirstChild().FirstChild() + if !bytes.Equal(c1.Text(s), []byte(cs.T1)) { // nolint: staticcheck + t.Errorf("%s unmatch:\n%s", cs.Name, testutil.DiffPretty(c1.Text(s), []byte(cs.T1))) // nolint: staticcheck + } + }) + } + +} + +func TestHasBlankPreviousLines(t *testing.T) { + var cases = []struct { + Name string + Source string + Node func(n ast.Node) ast.Node + Expected bool + }{ + { + Name: "nesting paragraphs in blockquotes", + Source: ` +> a +> +> b +`, + Node: func(n ast.Node) ast.Node { + return n.FirstChild().FirstChild().NextSibling() + }, + Expected: true, + }, + { + Name: "nesting HTML blocks in blockquotes", + Source: ` +> +> +> +`, + Node: func(n ast.Node) ast.Node { + return n.FirstChild().FirstChild().NextSibling() + }, + Expected: true, + }, + { + Name: "nesting HTML blocks in blockquotes", + Source: ` +> +> +`, + Node: func(n ast.Node) ast.Node { + return n.FirstChild().FirstChild().NextSibling() + }, + Expected: false, + }, + { + Name: "nesting loose lists in blockquotes", + Source: ` +> - a +> +> - b +`, + Node: func(n ast.Node) ast.Node { + return n.FirstChild().FirstChild().FirstChild().NextSibling() + }, + Expected: true, + }, + { + Name: "nesting tight lists in blockquotes", + Source: ` +> - a +> - b +`, + Node: func(n ast.Node) ast.Node { + return n.FirstChild().FirstChild().FirstChild().NextSibling() + }, + Expected: false, + }, + { + Name: "nesting paragraphs in lists", + Source: ` +- a + + b +`, + Node: func(n ast.Node) ast.Node { + return n.FirstChild().FirstChild().FirstChild().NextSibling() + }, + Expected: true, + }, + } + md := New() + for _, cs := range cases { + t.Run(cs.Name, func(t *testing.T) { + n := md.Parser().Parse(text.NewReader([]byte(cs.Source))) + if cs.Node(n).HasBlankPreviousLines() != cs.Expected { + t.Errorf("expected %v, got %v", cs.Expected, !cs.Expected) + } + }) + } +} + +func TestInlinePos(t *testing.T) { + markdown := New() + + source := []byte(`[bar][] + +[foo][bar] + +[bar] + +[foo](http://example.com) + +aaaa **b** + +![aaa](http://example.com/foo.png "title") + +[bar]: + /url "ti + tle" +`) + c := parser.NewContext() + n := markdown.Parser().Parse(text.NewReader(source), parser.WithContext(c)) + if 0 != n.FirstChild().FirstChild().Pos() { + t.Error("unexpected position for 1st link reference") + } + if 9 != n.FirstChild().NextSibling().FirstChild().Pos() { + t.Error("unexpected position for 2nd link reference") + } + if 21 != n.FirstChild().NextSibling().NextSibling().FirstChild().Pos() { + t.Error("unexpected position for 3rd link reference") + } + if 28 != n.FirstChild().NextSibling().NextSibling().NextSibling().FirstChild().Pos() { + t.Error("unexpected position for 1st inline link ") + } + if 60 != n.FirstChild().NextSibling().NextSibling().NextSibling().NextSibling().FirstChild().NextSibling().Pos() { + t.Error("unexpected position for 1st emphasis") + } + if 68 != n.FirstChild().NextSibling().NextSibling().NextSibling().NextSibling().NextSibling().FirstChild().Pos() { + t.Error("unexpected position for 1st image") + } +} diff --git a/commonmark_test.go b/commonmark_test.go new file mode 100644 index 0000000..b4422e8 --- /dev/null +++ b/commonmark_test.go @@ -0,0 +1,57 @@ +package goldmark_test + +import ( + "encoding/json" + "os" + "testing" + + . "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" +) + +type commonmarkSpecTestCase struct { + Markdown string `json:"markdown"` + HTML string `json:"html"` + Example int `json:"example"` + StartLine int `json:"start_line"` + EndLine int `json:"end_line"` + Section string `json:"section"` +} + +func TestSpec(t *testing.T) { + bs, err := os.ReadFile("_test/spec.json") + if err != nil { + panic(err) + } + var testCases []commonmarkSpecTestCase + if err := json.Unmarshal(bs, &testCases); err != nil { + panic(err) + } + cases := []testutil.MarkdownTestCase{} + nos := testutil.ParseCliCaseArg() + for _, c := range testCases { + shouldAdd := len(nos) == 0 + if !shouldAdd { + for _, no := range nos { + if c.Example == no { + shouldAdd = true + break + } + } + } + + if shouldAdd { + cases = append(cases, testutil.MarkdownTestCase{ + No: c.Example, + Markdown: c.Markdown, + Expected: c.HTML, + }) + } + } + markdown := New(WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + testutil.DoTestCases(markdown, cases, t) +} diff --git a/extension/_test/definition_list.txt b/extension/_test/definition_list.txt new file mode 100644 index 0000000..db40fcc --- /dev/null +++ b/extension/_test/definition_list.txt @@ -0,0 +1,157 @@ +1 +//- - - - - - - - -// +Apple +: Pomaceous fruit of plants of the genus Malus in +the family Rosaceae. + +Orange +: The fruit of an evergreen tree of the genus Citrus. +//- - - - - - - - -// +
+
Apple
+
Pomaceous fruit of plants of the genus Malus in +the family Rosaceae.
+
Orange
+
The fruit of an evergreen tree of the genus Citrus.
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +2 +//- - - - - - - - -// +Apple +: Pomaceous fruit of plants of the genus Malus in + the family Rosaceae. +: An American computer company. + +Orange +: The fruit of an evergreen tree of the genus Citrus. +//- - - - - - - - -// +
+
Apple
+
Pomaceous fruit of plants of the genus Malus in +the family Rosaceae.
+
An American computer company.
+
Orange
+
The fruit of an evergreen tree of the genus Citrus.
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +3 +//- - - - - - - - -// +Term 1 +Term 2 +: Definition a + +Term 3 +: Definition b +//- - - - - - - - -// +
+
Term 1
+
Term 2
+
Definition a
+
Term 3
+
Definition b
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +4 +//- - - - - - - - -// +Apple + +: Pomaceous fruit of plants of the genus Malus in + the family Rosaceae. + +Orange + +: The fruit of an evergreen tree of the genus Citrus. +//- - - - - - - - -// +
+
Apple
+
+

Pomaceous fruit of plants of the genus Malus in +the family Rosaceae.

+
+
Orange
+
+

The fruit of an evergreen tree of the genus Citrus.

+
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +5 +//- - - - - - - - -// +Term 1 + +: This is a definition with two paragraphs. Lorem ipsum + dolor sit amet, consectetuer adipiscing elit. Aliquam + hendrerit mi posuere lectus. + + Vestibulum enim wisi, viverra nec, fringilla in, laoreet + vitae, risus. + +: Second definition for term 1, also wrapped in a paragraph + because of the blank line preceding it. + +Term 2 + +: This definition has a code block, a blockquote and a list. + + code block. + + > block quote + > on two lines. + + 1. first list item + 2. second list item +//- - - - - - - - -// +
+
Term 1
+
+

This is a definition with two paragraphs. Lorem ipsum +dolor sit amet, consectetuer adipiscing elit. Aliquam +hendrerit mi posuere lectus.

+

Vestibulum enim wisi, viverra nec, fringilla in, laoreet +vitae, risus.

+
+
+

Second definition for term 1, also wrapped in a paragraph +because of the blank line preceding it.

+
+
Term 2
+
+

This definition has a code block, a blockquote and a list.

+
code block.
+
+
+

block quote +on two lines.

+
+
    +
  1. first list item
  2. +
  3. second list item
  4. +
+
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +6: Definition lists indented with tabs +//- - - - - - - - -// +0 +: ``` + 0 +//- - - - - - - - -// +
+
0
+
	0
+
+
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// diff --git a/extension/_test/footnote.txt b/extension/_test/footnote.txt new file mode 100644 index 0000000..12fbe83 --- /dev/null +++ b/extension/_test/footnote.txt @@ -0,0 +1,91 @@ +1 +//- - - - - - - - -// +That's some text with a footnote.[^1] + +[^1]: And that's the footnote. + + That's the second paragraph. +//- - - - - - - - -// +

That's some text with a footnote.1

+
+
+
    +
  1. +

    And that's the footnote.

    +

    That's the second paragraph. ↩︎

    +
  2. +
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +3 +//- - - - - - - - -// +[^000]:0 [^]: +//- - - - - - - - -// +//= = = = = = = = = = = = = = = = = = = = = = = =// + +4 +//- - - - - - - - -// +This[^3] is[^1] text with footnotes[^2]. + +[^1]: Footnote one +[^2]: Footnote two +[^3]: Footnote three +//- - - - - - - - -// +

This1 is2 text with footnotes3.

+
+
+
    +
  1. +

    Footnote three ↩︎

    +
  2. +
  3. +

    Footnote one ↩︎

    +
  4. +
  5. +

    Footnote two ↩︎

    +
  6. +
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +5 +//- - - - - - - - -// +test![^1] + +[^1]: footnote +//- - - - - - - - -// +

test!1

+
+
+
    +
  1. +

    footnote ↩︎

    +
  2. +
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +6: Multiple references to the same footnotes should have different ids +//- - - - - - - - -// +something[^fn:1] + +something[^fn:1] + +something[^fn:1] + +[^fn:1]: footnote text +//- - - - - - - - -// +

something1

+

something1

+

something1

+
+
+
    +
  1. +

    footnote text ↩︎ ↩︎ ↩︎

    +
  2. +
+
+//= = = = = = = = = = = = = = = = = = = = = = = =// diff --git a/extension/_test/linkify.txt b/extension/_test/linkify.txt new file mode 100644 index 0000000..4791f3c --- /dev/null +++ b/extension/_test/linkify.txt @@ -0,0 +1,193 @@ +1 +//- - - - - - - - -// +www.commonmark.org +//- - - - - - - - -// +

www.commonmark.org

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +2 +//- - - - - - - - -// +Visit www.commonmark.org/help for more information. +//- - - - - - - - -// +

Visit www.commonmark.org/help for more information.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +3 +//- - - - - - - - -// +www.google.com/search?q=Markup+(business) + +www.google.com/search?q=Markup+(business))) + +(www.google.com/search?q=Markup+(business)) + +(www.google.com/search?q=Markup+(business) +//- - - - - - - - -// +

www.google.com/search?q=Markup+(business)

+

www.google.com/search?q=Markup+(business)))

+

(www.google.com/search?q=Markup+(business))

+

(www.google.com/search?q=Markup+(business)

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +4 +//- - - - - - - - -// +www.google.com/search?q=(business))+ok +//- - - - - - - - -// +

www.google.com/search?q=(business))+ok

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +5 +//- - - - - - - - -// +www.google.com/search?q=commonmark&hl=en + +www.google.com/search?q=commonmark&hl; +//- - - - - - - - -// +

www.google.com/search?q=commonmark&hl=en

+

www.google.com/search?q=commonmark&hl;

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +6 +//- - - - - - - - -// +www.commonmark.org/hewww.commonmark.org/he<lp

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +7 +//- - - - - - - - -// +http://commonmark.org + +(Visit https://encrypted.google.com/search?q=Markup+(business)) + +Anonymous FTP is available at ftp://foo.bar.baz. +//- - - - - - - - -// +

http://commonmark.org

+

(Visit https://encrypted.google.com/search?q=Markup+(business))

+

Anonymous FTP is available at ftp://foo.bar.baz.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +8 +//- - - - - - - - -// +foo@bar.baz +//- - - - - - - - -// +

foo@bar.baz

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +9 +//- - - - - - - - -// +hello@mail+xyz.example isn't valid, but hello+xyz@mail.example is. +//- - - - - - - - -// +

hello@mail+xyz.example isn't valid, but hello+xyz@mail.example is.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +10 +//- - - - - - - - -// +a.b-c_d@a.b + +a.b-c_d@a.b. + +a.b-c_d@a.b- + +a.b-c_d@a.b_ +//- - - - - - - - -// +

a.b-c_d@a.b

+

a.b-c_d@a.b.

+

a.b-c_d@a.b-

+

a.b-c_d@a.b_

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +11 +//- - - - - - - - -// +https://github.com#sun,mon +//- - - - - - - - -// +

https://github.com#sun,mon

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +12 +//- - - - - - - - -// +https://github.com/sunday's +//- - - - - - - - -// +

https://github.com/sunday's

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +13 +//- - - - - - - - -// +https://github.com?q=stars:>1 +//- - - - - - - - -// +

https://github.com?q=stars:>1

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +14 +//- - - - - - - - -// +[https://google.com](https://google.com) +//- - - - - - - - -// +

https://google.com

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +15 +//- - - - - - - - -// +This is a `git@github.com:vim/vim` +//- - - - - - - - -// +

This is a git@github.com:vim/vim

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +16 +//- - - - - - - - -// +https://nic.college +//- - - - - - - - -// +

https://nic.college

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +17 +//- - - - - - - - -// +http://server.intranet.acme.com:1313 +//- - - - - - - - -// +

http://server.intranet.acme.com:1313

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +18 +//- - - - - - - - -// +https://g.page/foo +//- - - - - - - - -// +

https://g.page/foo

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +19: Trailing punctuation (specifically, ?, !, ., ,, :, *, _, and ~) will not be considered part of the autolink +//- - - - - - - - -// +__http://test.com/~/a__ +__http://test.com/~/__ +__http://test.com/~__ +__http://test.com/a/~__ +//- - - - - - - - -// +

http://test.com/~/a +http://test.com/~/ +http://test.com/~ +http://test.com/a/~

+//= = = = = = = = = = = = = = = = = = = = = = = =// diff --git a/extension/_test/strikethrough.txt b/extension/_test/strikethrough.txt new file mode 100644 index 0000000..5f37627 --- /dev/null +++ b/extension/_test/strikethrough.txt @@ -0,0 +1,39 @@ +1 +//- - - - - - - - -// +~~Hi~~ Hello, world! +//- - - - - - - - -// +

Hi Hello, world!

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +2 +//- - - - - - - - -// +This ~~has a + +new paragraph~~. +//- - - - - - - - -// +

This ~~has a

+

new paragraph~~.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +3 +//- - - - - - - - -// +~Hi~ Hello, world! +//- - - - - - - - -// +

Hi Hello, world!

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +4: Three or more tildes do not create a strikethrough +//- - - - - - - - -// +This will ~~~not~~~ strike. +//- - - - - - - - -// +

This will ~~~not~~~ strike.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +5: Leading three or more tildes do not create a strikethrough, create a code block +//- - - - - - - - -// +~~~Hi~~~ Hello, world! +//- - - - - - - - -// +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + diff --git a/extension/_test/table.txt b/extension/_test/table.txt new file mode 100644 index 0000000..eef5b67 --- /dev/null +++ b/extension/_test/table.txt @@ -0,0 +1,293 @@ +1 +//- - - - - - - - -// +| foo | bar | +| --- | --- | +| baz | bim | +//- - - - - - - - -// + + + + + + + + + + + + + +
foobar
bazbim
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +2 +//- - - - - - - - -// +| abc | defghi | +:-: | -----------: +bar | baz +//- - - - - - - - -// + + + + + + + + + + + + + +
abcdefghi
barbaz
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +3 +//- - - - - - - - -// +| f\|oo | +| ------ | +| b `\|` az | +| b **\|** im | +//- - - - - - - - -// + + + + + + + + + + + + + + +
f|oo
b | az
b | im
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +4 +//- - - - - - - - -// +| abc | def | +| --- | --- | +| bar | baz | +> bar +//- - - - - - - - -// + + + + + + + + + + + + + +
abcdef
barbaz
+
+

bar

+
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +5 +//- - - - - - - - -// +| abc | def | +| --- | --- | +| bar | baz | +bar + +bar +//- - - - - - - - -// + + + + + + + + + + + + + + + + + +
abcdef
barbaz
bar
+

bar

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +6 +//- - - - - - - - -// +| abc | def | +| --- | +| bar | +//- - - - - - - - -// +

| abc | def | +| --- | +| bar |

+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +7 +//- - - - - - - - -// +| abc | def | +| --- | --- | +| bar | +| bar | baz | boo | +//- - - - - - - - -// + + + + + + + + + + + + + + + + + +
abcdef
bar
barbaz
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +8 +//- - - - - - - - -// +| abc | def | +| --- | --- | +//- - - - - - - - -// + + + + + + + +
abcdef
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +9 +//- - - - - - - - -// +Foo|Bar +---|--- +`Yoyo`|Dyne +//- - - - - - - - -// + + + + + + + + + + + + + +
FooBar
YoyoDyne
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +10 +//- - - - - - - - -// +foo|bar +---|--- +`\` | second column +//- - - - - - - - -// + + + + + + + + + + + + + +
foobar
\second column
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +11: Tables can interrupt paragraph +//- - - - - - - - -// +**xxx** +| hello | hi | +| :----: | :----:| +//- - - - - - - - -// +

xxx

+ + + + + + + +
hellohi
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +12: A delimiter can not start with more than 3 spaces +//- - - - - - - - -// +Foo + --- +//- - - - - - - - -// +

Foo +---

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +13: A delimiter can not start with more than 3 spaces(w/ tabs) + OPTIONS: {"enableEscape": true} +//- - - - - - - - -// +- aaa + + Foo +\t\t--- +//- - - - - - - - -// +
    +
  • +

    aaa

    +

    Foo +---

    +
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + +14: Delimiter-like line inside a list item +//- - - - - - - - -// +- [Marketing](marketing/_index.md) +-- +//- - - - - - - - -// + +//= = = = = = = = = = = = = = = = = = = = = = = =// + diff --git a/extension/_test/tasklist.txt b/extension/_test/tasklist.txt new file mode 100644 index 0000000..256eca4 --- /dev/null +++ b/extension/_test/tasklist.txt @@ -0,0 +1,51 @@ +1 +//- - - - - - - - -// +- [ ] foo +- [x] bar +//- - - - - - - - -// +
    +
  • foo
  • +
  • bar
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +2 +//- - - - - - - - -// +- [x] foo + - [ ] bar + - [x] baz +- [ ] bim +//- - - - - - - - -// +
    +
  • foo +
      +
    • bar
    • +
    • baz
    • +
    +
  • +
  • bim
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + + +3 +//- - - - - - - - -// +- test[x]=[x] +//- - - - - - - - -// +
    +
  • test[x]=[x]
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// + + +4 +//- - - - - - - - -// ++ [x] [x] +//- - - - - - - - -// +
    +
  • [x]
  • +
+//= = = = = = = = = = = = = = = = = = = = = = = =// diff --git a/extension/_test/typographer.txt b/extension/_test/typographer.txt new file mode 100644 index 0000000..cf5fea6 --- /dev/null +++ b/extension/_test/typographer.txt @@ -0,0 +1,143 @@ +1 +//- - - - - - - - -// +This should 'be' replaced +//- - - - - - - - -// +

This should ‘be’ replaced

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +2 +//- - - - - - - - -// +This should "be" replaced +//- - - - - - - - -// +

This should “be” replaced

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +3 +//- - - - - - - - -// +**--** *---* a...<< b>> +//- - - - - - - - -// +

a…« b»

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +4 +//- - - - - - - - -// +Some say '90s, others say 90's, but I can't say which is best. +//- - - - - - - - -// +

Some say ’90s, others say 90’s, but I can’t say which is best.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +5: contractions +//- - - - - - - - -// +Alice's, I'm ,Don't, You'd + +I've, I'll, You're + +[Cat][]'s Pajamas + +Yahoo!'s + +[Cat]: http://example.com +//- - - - - - - - -// +

Alice’s, I’m ,Don’t, You’d

+

I’ve, I’ll, You’re

+

Cat’s Pajamas

+

Yahoo!’s

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +6: "" after digits are an inch +//- - - - - - - - -// +My height is 5'6"". +//- - - - - - - - -// +

My height is 5'6"".

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +7: quote followed by ,.?! and spaces maybe a closer +//- - - - - - - - -// +reported "issue 1 (IE-only)", "issue 2", 'issue3 (FF-only)', 'issue4' +//- - - - - - - - -// +

reported “issue 1 (IE-only)”, “issue 2”, ‘issue3 (FF-only)’, ‘issue4’

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +8: handle inches in qoutes +//- - - - - - - - -// +"Monitor 21"" and "Monitor"" +//- - - - - - - - -// +

“Monitor 21"” and “Monitor”"

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +9: Closing quotation marks within italics +//- - - - - - - - -// +*"At first, things were not clear."* +//- - - - - - - - -// +

“At first, things were not clear.”

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +10: Closing quotation marks within boldfacing +//- - - - - - - - -// +**"At first, things were not clear."** +//- - - - - - - - -// +

“At first, things were not clear.”

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +11: Closing quotation marks within boldfacing and italics +//- - - - - - - - -// +***"At first, things were not clear."*** +//- - - - - - - - -// +

“At first, things were not clear.”

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +12: Closing quotation marks within boldfacing and italics +//- - - - - - - - -// +***"At first, things were not clear."*** +//- - - - - - - - -// +

“At first, things were not clear.”

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +13: Plural possessives +//- - - - - - - - -// +John's dog is named Sam. The Smiths' dog is named Rover. +//- - - - - - - - -// +

John’s dog is named Sam. The Smiths’ dog is named Rover.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +14: Links within quotation marks and parenthetical phrases +//- - - - - - - - -// +This is not difficult (see "[Introduction to Hugo Templating](https://gohugo.io/templates/introduction/)"). +//- - - - - - - - -// +

This is not difficult (see “Introduction to Hugo Templating”).

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +15: Quotation marks within links +//- - - - - - - - -// +Apple's early Cairo font gave us ["moof" and the "dogcow."](https://www.macworld.com/article/2926184/we-miss-you-clarus-the-dogcow.html) +//- - - - - - - - -// +

Apple’s early Cairo font gave us “moof” and the “dogcow.”

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +16: Single closing quotation marks with slang/informalities +//- - - - - - - - -// +"I'm not doin' that," Bill said with emphasis. +//- - - - - - - - -// +

“I’m not doin’ that,” Bill said with emphasis.

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +17: Closing single quotation marks in quotations-within-quotations +//- - - - - - - - -// +Janet said, "When everything is 'breaking news,' nothing is 'breaking news.'" +//- - - - - - - - -// +

Janet said, “When everything is ‘breaking news,’ nothing is ‘breaking news.’”

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +18: Opening single quotation marks for abbreviations +//- - - - - - - - -// +We're talking about the internet --- 'net for short. Let's rock 'n roll! +//- - - - - - - - -// +

We’re talking about the internet — ’net for short. Let’s rock ’n roll!

+//= = = = = = = = = = = = = = = = = = = = = = = =// + +19: Quotes in alt text +//- - - - - - - - -// +![Nice & day, **isn't** it?](https://example.com/image.jpg) +//- - - - - - - - -// +

Nice & day, isn’t it?

+//= = = = = = = = = = = = = = = = = = = = = = = =// diff --git a/extension/ast/definition_list.go b/extension/ast/definition_list.go new file mode 100644 index 0000000..0ff7412 --- /dev/null +++ b/extension/ast/definition_list.go @@ -0,0 +1,99 @@ +package ast + +import ( + gast "github.com/yuin/goldmark/ast" +) + +// A DefinitionList struct represents a definition list of Markdown +// (PHPMarkdownExtra) text. +type DefinitionList struct { + gast.BaseBlock + Offset int + TemporaryParagraph *gast.Paragraph +} + +// Dump implements Node.Dump. +func (n *DefinitionList) Dump(source []byte, level int) { + gast.DumpHelper(n, source, level, nil, nil) +} + +// Pos implements Node.Pos. +func (n *DefinitionList) Pos() int { + if n.FirstChild() != nil { + return n.FirstChild().Pos() + } + return -1 +} + +// KindDefinitionList is a NodeKind of the DefinitionList node. +var KindDefinitionList = gast.NewNodeKind("DefinitionList") + +// Kind implements Node.Kind. +func (n *DefinitionList) Kind() gast.NodeKind { + return KindDefinitionList +} + +// NewDefinitionList returns a new DefinitionList node. +func NewDefinitionList(offset int, para *gast.Paragraph) *DefinitionList { + return &DefinitionList{ + Offset: offset, + TemporaryParagraph: para, + } +} + +// A DefinitionTerm struct represents a definition list term of Markdown +// (PHPMarkdownExtra) text. +type DefinitionTerm struct { + gast.BaseBlock +} + +// Dump implements Node.Dump. +func (n *DefinitionTerm) Dump(source []byte, level int) { + gast.DumpHelper(n, source, level, nil, nil) +} + +// Pos implements Node.Pos. +func (n *DefinitionTerm) Pos() int { + if n.Lines().Len() == 0 { + return -1 + } + return n.Lines().At(0).Start +} + +// KindDefinitionTerm is a NodeKind of the DefinitionTerm node. +var KindDefinitionTerm = gast.NewNodeKind("DefinitionTerm") + +// Kind implements Node.Kind. +func (n *DefinitionTerm) Kind() gast.NodeKind { + return KindDefinitionTerm +} + +// NewDefinitionTerm returns a new DefinitionTerm node. +func NewDefinitionTerm() *DefinitionTerm { + return &DefinitionTerm{} +} + +// A DefinitionDescription struct represents a definition list description of Markdown +// (PHPMarkdownExtra) text. +type DefinitionDescription struct { + gast.BaseBlock + IsTight bool +} + +// Dump implements Node.Dump. +func (n *DefinitionDescription) Dump(source []byte, level int) { + gast.DumpHelper(n, source, level, nil, nil) +} + +// KindDefinitionDescription is a NodeKind of the DefinitionDescription node. +var KindDefinitionDescription = gast.NewNodeKind("DefinitionDescription") + +// Kind implements Node.Kind. +func (n *DefinitionDescription) Kind() gast.NodeKind { + return KindDefinitionDescription +} + +// NewDefinitionDescription returns a new DefinitionDescription node. +func NewDefinitionDescription() *DefinitionDescription { + return &DefinitionDescription{} +} diff --git a/extension/ast/footnote.go b/extension/ast/footnote.go new file mode 100644 index 0000000..b24eafe --- /dev/null +++ b/extension/ast/footnote.go @@ -0,0 +1,138 @@ +package ast + +import ( + "fmt" + + gast "github.com/yuin/goldmark/ast" +) + +// A FootnoteLink struct represents a link to a footnote of Markdown +// (PHP Markdown Extra) text. +type FootnoteLink struct { + gast.BaseInline + Index int + RefCount int + RefIndex int +} + +// Dump implements Node.Dump. +func (n *FootnoteLink) Dump(source []byte, level int) { + m := map[string]string{} + m["Index"] = fmt.Sprintf("%v", n.Index) + m["RefCount"] = fmt.Sprintf("%v", n.RefCount) + m["RefIndex"] = fmt.Sprintf("%v", n.RefIndex) + gast.DumpHelper(n, source, level, m, nil) +} + +// KindFootnoteLink is a NodeKind of the FootnoteLink node. +var KindFootnoteLink = gast.NewNodeKind("FootnoteLink") + +// Kind implements Node.Kind. +func (n *FootnoteLink) Kind() gast.NodeKind { + return KindFootnoteLink +} + +// NewFootnoteLink returns a new FootnoteLink node. +func NewFootnoteLink(index int) *FootnoteLink { + return &FootnoteLink{ + Index: index, + RefCount: 0, + RefIndex: 0, + } +} + +// A FootnoteBacklink struct represents a link to a footnote of Markdown +// (PHP Markdown Extra) text. +type FootnoteBacklink struct { + gast.BaseInline + Index int + RefCount int + RefIndex int +} + +// Dump implements Node.Dump. +func (n *FootnoteBacklink) Dump(source []byte, level int) { + m := map[string]string{} + m["Index"] = fmt.Sprintf("%v", n.Index) + m["RefCount"] = fmt.Sprintf("%v", n.RefCount) + m["RefIndex"] = fmt.Sprintf("%v", n.RefIndex) + gast.DumpHelper(n, source, level, m, nil) +} + +// KindFootnoteBacklink is a NodeKind of the FootnoteBacklink node. +var KindFootnoteBacklink = gast.NewNodeKind("FootnoteBacklink") + +// Kind implements Node.Kind. +func (n *FootnoteBacklink) Kind() gast.NodeKind { + return KindFootnoteBacklink +} + +// NewFootnoteBacklink returns a new FootnoteBacklink node. +func NewFootnoteBacklink(index int) *FootnoteBacklink { + return &FootnoteBacklink{ + Index: index, + RefCount: 0, + RefIndex: 0, + } +} + +// A Footnote struct represents a footnote of Markdown +// (PHP Markdown Extra) text. +type Footnote struct { + gast.BaseBlock + Ref []byte + Index int +} + +// Dump implements Node.Dump. +func (n *Footnote) Dump(source []byte, level int) { + m := map[string]string{} + m["Index"] = fmt.Sprintf("%v", n.Index) + m["Ref"] = string(n.Ref) + gast.DumpHelper(n, source, level, m, nil) +} + +// KindFootnote is a NodeKind of the Footnote node. +var KindFootnote = gast.NewNodeKind("Footnote") + +// Kind implements Node.Kind. +func (n *Footnote) Kind() gast.NodeKind { + return KindFootnote +} + +// NewFootnote returns a new Footnote node. +func NewFootnote(ref []byte) *Footnote { + return &Footnote{ + Ref: ref, + Index: -1, + } +} + +// A FootnoteList struct represents footnotes of Markdown +// (PHP Markdown Extra) text. +type FootnoteList struct { + gast.BaseBlock + Count int +} + +// Dump implements Node.Dump. +func (n *FootnoteList) Dump(source []byte, level int) { + m := map[string]string{} + m["Count"] = fmt.Sprintf("%v", n.Count) + gast.DumpHelper(n, source, level, m, nil) +} + +// KindFootnoteList is a NodeKind of the FootnoteList node. +var KindFootnoteList = gast.NewNodeKind("FootnoteList") + +// Kind implements Node.Kind. +func (n *FootnoteList) Kind() gast.NodeKind { + return KindFootnoteList +} + +// NewFootnoteList returns a new FootnoteList node. +func NewFootnoteList() *FootnoteList { + return &FootnoteList{ + Count: 0, + } +} diff --git a/extension/ast/strikethrough.go b/extension/ast/strikethrough.go new file mode 100644 index 0000000..a9216b7 --- /dev/null +++ b/extension/ast/strikethrough.go @@ -0,0 +1,29 @@ +// Package ast defines AST nodes that represents extension's elements +package ast + +import ( + gast "github.com/yuin/goldmark/ast" +) + +// A Strikethrough struct represents a strikethrough of GFM text. +type Strikethrough struct { + gast.BaseInline +} + +// Dump implements Node.Dump. +func (n *Strikethrough) Dump(source []byte, level int) { + gast.DumpHelper(n, source, level, nil, nil) +} + +// KindStrikethrough is a NodeKind of the Strikethrough node. +var KindStrikethrough = gast.NewNodeKind("Strikethrough") + +// Kind implements Node.Kind. +func (n *Strikethrough) Kind() gast.NodeKind { + return KindStrikethrough +} + +// NewStrikethrough returns a new Strikethrough node. +func NewStrikethrough() *Strikethrough { + return &Strikethrough{} +} diff --git a/extension/ast/table.go b/extension/ast/table.go new file mode 100644 index 0000000..ba87048 --- /dev/null +++ b/extension/ast/table.go @@ -0,0 +1,159 @@ +package ast + +import ( + "fmt" + "strings" + + gast "github.com/yuin/goldmark/ast" +) + +// Alignment is a text alignment of table cells. +type Alignment int + +const ( + // AlignLeft indicates text should be left justified. + AlignLeft Alignment = iota + 1 + + // AlignRight indicates text should be right justified. + AlignRight + + // AlignCenter indicates text should be centered. + AlignCenter + + // AlignNone indicates text should be aligned by default manner. + AlignNone +) + +func (a Alignment) String() string { + switch a { + case AlignLeft: + return "left" + case AlignRight: + return "right" + case AlignCenter: + return "center" + case AlignNone: + return "none" + } + return "" +} + +// A Table struct represents a table of Markdown(GFM) text. +type Table struct { + gast.BaseBlock + + // Alignments returns alignments of the columns. + Alignments []Alignment +} + +// Dump implements Node.Dump. +func (n *Table) Dump(source []byte, level int) { + gast.DumpHelper(n, source, level, nil, func(level int) { + indent := strings.Repeat(" ", level) + fmt.Printf("%sAlignments {\n", indent) + for i, alignment := range n.Alignments { + indent2 := strings.Repeat(" ", level+1) + fmt.Printf("%s%s", indent2, alignment.String()) + if i != len(n.Alignments)-1 { + fmt.Println("") + } + } + fmt.Printf("\n%s}\n", indent) + }) +} + +// KindTable is a NodeKind of the Table node. +var KindTable = gast.NewNodeKind("Table") + +// Kind implements Node.Kind. +func (n *Table) Kind() gast.NodeKind { + return KindTable +} + +// NewTable returns a new Table node. +func NewTable() *Table { + return &Table{ + Alignments: []Alignment{}, + } +} + +// A TableRow struct represents a table row of Markdown(GFM) text. +type TableRow struct { + gast.BaseBlock + Alignments []Alignment +} + +// Dump implements Node.Dump. +func (n *TableRow) Dump(source []byte, level int) { + gast.DumpHelper(n, source, level, nil, nil) +} + +// KindTableRow is a NodeKind of the TableRow node. +var KindTableRow = gast.NewNodeKind("TableRow") + +// Kind implements Node.Kind. +func (n *TableRow) Kind() gast.NodeKind { + return KindTableRow +} + +// NewTableRow returns a new TableRow node. +func NewTableRow(alignments []Alignment) *TableRow { + return &TableRow{Alignments: alignments} +} + +// A TableHeader struct represents a table header of Markdown(GFM) text. +type TableHeader struct { + gast.BaseBlock + Alignments []Alignment +} + +// KindTableHeader is a NodeKind of the TableHeader node. +var KindTableHeader = gast.NewNodeKind("TableHeader") + +// Kind implements Node.Kind. +func (n *TableHeader) Kind() gast.NodeKind { + return KindTableHeader +} + +// Dump implements Node.Dump. +func (n *TableHeader) Dump(source []byte, level int) { + gast.DumpHelper(n, source, level, nil, nil) +} + +// NewTableHeader returns a new TableHeader node. +func NewTableHeader(row *TableRow) *TableHeader { + n := &TableHeader{} + n.SetPos(row.Pos()) + for c := row.FirstChild(); c != nil; { + next := c.NextSibling() + n.AppendChild(n, c) + c = next + } + return n +} + +// A TableCell struct represents a table cell of a Markdown(GFM) text. +type TableCell struct { + gast.BaseBlock + Alignment Alignment +} + +// Dump implements Node.Dump. +func (n *TableCell) Dump(source []byte, level int) { + gast.DumpHelper(n, source, level, nil, nil) +} + +// KindTableCell is a NodeKind of the TableCell node. +var KindTableCell = gast.NewNodeKind("TableCell") + +// Kind implements Node.Kind. +func (n *TableCell) Kind() gast.NodeKind { + return KindTableCell +} + +// NewTableCell returns a new TableCell node. +func NewTableCell() *TableCell { + return &TableCell{ + Alignment: AlignNone, + } +} diff --git a/extension/ast/tasklist.go b/extension/ast/tasklist.go new file mode 100644 index 0000000..16abf95 --- /dev/null +++ b/extension/ast/tasklist.go @@ -0,0 +1,36 @@ +package ast + +import ( + "fmt" + + gast "github.com/yuin/goldmark/ast" +) + +// A TaskCheckBox struct represents a checkbox of a task list. +type TaskCheckBox struct { + gast.BaseInline + IsChecked bool +} + +// Dump implements Node.Dump. +func (n *TaskCheckBox) Dump(source []byte, level int) { + m := map[string]string{ + "Checked": fmt.Sprintf("%v", n.IsChecked), + } + gast.DumpHelper(n, source, level, m, nil) +} + +// KindTaskCheckBox is a NodeKind of the TaskCheckBox node. +var KindTaskCheckBox = gast.NewNodeKind("TaskCheckBox") + +// Kind implements Node.Kind. +func (n *TaskCheckBox) Kind() gast.NodeKind { + return KindTaskCheckBox +} + +// NewTaskCheckBox returns a new TaskCheckBox node. +func NewTaskCheckBox(checked bool) *TaskCheckBox { + return &TaskCheckBox{ + IsChecked: checked, + } +} diff --git a/extension/ast_test.go b/extension/ast_test.go new file mode 100644 index 0000000..8fb4039 --- /dev/null +++ b/extension/ast_test.go @@ -0,0 +1,123 @@ +package extension + +import ( + "bytes" + "testing" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" + "github.com/yuin/goldmark/text" +) + +func TestASTBlockNodeText(t *testing.T) { + var cases = []struct { + Name string + Source string + T1 string + T2 string + C bool + }{ + { + Name: "DefinitionList", + Source: `c1 +: c2 + c3 + +a + +c4 +: c5 + c6`, + T1: `c1c2 +c3`, + T2: `c4c5 +c6`, + }, + { + Name: "Table", + Source: `| h1 | h2 | +| -- | -- | +| c1 | c2 | + +a + + +| h3 | h4 | +| -- | -- | +| c3 | c4 |`, + + T1: `h1h2c1c2`, + T2: `h3h4c3c4`, + }, + } + + for _, cs := range cases { + t.Run(cs.Name, func(t *testing.T) { + s := []byte(cs.Source) + md := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + DefinitionList, + Table, + ), + ) + n := md.Parser().Parse(text.NewReader(s)) + c1 := n.FirstChild() + c2 := c1.NextSibling().NextSibling() + if cs.C { + c1 = c1.FirstChild() + c2 = c2.FirstChild() + } + if !bytes.Equal(c1.Text(s), []byte(cs.T1)) { // nolint: staticcheck + + t.Errorf("%s unmatch:\n%s", cs.Name, testutil.DiffPretty(c1.Text(s), []byte(cs.T1))) // nolint: staticcheck + + } + if !bytes.Equal(c2.Text(s), []byte(cs.T2)) { // nolint: staticcheck + + t.Errorf("%s(EOF) unmatch: %s", cs.Name, testutil.DiffPretty(c2.Text(s), []byte(cs.T2))) // nolint: staticcheck + + } + }) + } + +} + +func TestASTInlineNodeText(t *testing.T) { + var cases = []struct { + Name string + Source string + T1 string + }{ + { + Name: "Strikethrough", + Source: `~c1 *c2*~`, + T1: `c1 c2`, + }, + } + + for _, cs := range cases { + t.Run(cs.Name, func(t *testing.T) { + s := []byte(cs.Source) + md := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + Strikethrough, + ), + ) + n := md.Parser().Parse(text.NewReader(s)) + c1 := n.FirstChild().FirstChild() + if !bytes.Equal(c1.Text(s), []byte(cs.T1)) { // nolint: staticcheck + + t.Errorf("%s unmatch:\n%s", cs.Name, testutil.DiffPretty(c1.Text(s), []byte(cs.T1))) // nolint: staticcheck + + } + }) + } + +} diff --git a/extension/cjk.go b/extension/cjk.go new file mode 100644 index 0000000..a3238c2 --- /dev/null +++ b/extension/cjk.go @@ -0,0 +1,72 @@ +package extension + +import ( + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer/html" +) + +// A CJKOption sets options for CJK support mostly for HTML based renderers. +type CJKOption func(*cjk) + +// A EastAsianLineBreaks is a style of east asian line breaks. +type EastAsianLineBreaks int + +const ( + //EastAsianLineBreaksNone renders line breaks as it is. + EastAsianLineBreaksNone EastAsianLineBreaks = iota + // EastAsianLineBreaksSimple is a style where soft line breaks are ignored + // if both sides of the break are east asian wide characters. + EastAsianLineBreaksSimple + // EastAsianLineBreaksCSS3Draft is a style where soft line breaks are ignored + // even if only one side of the break is an east asian wide character. + EastAsianLineBreaksCSS3Draft +) + +// WithEastAsianLineBreaks is a functional option that indicates whether softline breaks +// between east asian wide characters should be ignored. +// style defauts to [EastAsianLineBreaksSimple] . +func WithEastAsianLineBreaks(style ...EastAsianLineBreaks) CJKOption { + return func(c *cjk) { + if len(style) == 0 { + c.EastAsianLineBreaks = EastAsianLineBreaksSimple + return + } + c.EastAsianLineBreaks = style[0] + } +} + +// WithEscapedSpace is a functional option that indicates that a '\' escaped half-space(0x20) should not be rendered. +func WithEscapedSpace() CJKOption { + return func(c *cjk) { + c.EscapedSpace = true + } +} + +type cjk struct { + EastAsianLineBreaks EastAsianLineBreaks + EscapedSpace bool +} + +// CJK is a goldmark extension that provides functionalities for CJK languages. +var CJK = NewCJK(WithEastAsianLineBreaks(), WithEscapedSpace()) + +// NewCJK returns a new extension with given options. +func NewCJK(opts ...CJKOption) goldmark.Extender { + e := &cjk{ + EastAsianLineBreaks: EastAsianLineBreaksNone, + } + for _, opt := range opts { + opt(e) + } + return e +} + +func (e *cjk) Extend(m goldmark.Markdown) { + m.Renderer().AddOptions(html.WithEastAsianLineBreaks( + html.EastAsianLineBreaks(e.EastAsianLineBreaks))) + if e.EscapedSpace { + m.Renderer().AddOptions(html.WithWriter(html.NewWriter(html.WithEscapedSpace()))) + m.Parser().AddOptions(parser.WithEscapedSpace()) + } +} diff --git a/extension/cjk_test.go b/extension/cjk_test.go new file mode 100644 index 0000000..0eaa26c --- /dev/null +++ b/extension/cjk_test.go @@ -0,0 +1,269 @@ +package extension + +import ( + "testing" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" +) + +func TestEscapedSpace(t *testing.T) { + markdown := goldmark.New(goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + no := 1 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Without spaces around an emphasis started with east asian punctuations, it is not interpreted as an emphasis(as defined in CommonMark spec)", + Markdown: "太郎は**「こんにちわ」**と言った\nんです", + Expected: "

太郎は**「こんにちわ」**と言った\nんです

", + }, + t, + ) + + no = 2 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "With spaces around an emphasis started with east asian punctuations, it is interpreted as an emphasis(but remains unnecessary spaces)", + Markdown: "太郎は **「こんにちわ」** と言った\nんです", + Expected: "

太郎は 「こんにちわ」 と言った\nんです

", + }, + t, + ) + + // Enables EscapedSpace + markdown = goldmark.New(goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions(NewCJK(WithEscapedSpace())), + ) + + no = 3 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "With spaces around an emphasis started with east asian punctuations,it is interpreted as an emphasis", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言った\nんです", + Expected: "

太郎は「こんにちわ」と言った\nんです

", + }, + t, + ) + + // ' ' triggers Linkify extension inline parser. + // Escaped spaces should not trigger the inline parser. + + markdown = goldmark.New(goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewCJK(WithEscapedSpace()), + Linkify, + ), + ) + + no = 4 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Escaped space and linkfy extension", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言った\nんです", + Expected: "

太郎は「こんにちわ」と言った\nんです

", + }, + t, + ) +} + +func TestEastAsianLineBreaks(t *testing.T) { + markdown := goldmark.New(goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + no := 1 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks are rendered as a newline, so some asian users will see it as an unnecessary space", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言った\nんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言った\nんです

", + }, + t, + ) + + // Enables EastAsianLineBreaks + + markdown = goldmark.New(goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions(NewCJK(WithEastAsianLineBreaks())), + ) + + no = 2 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between east asian wide characters are ignored", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言った\nんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言ったんです

", + }, + t, + ) + + no = 3 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between western characters are rendered as a newline", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言ったa\nbんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言ったa\nbんです

", + }, + t, + ) + + no = 4 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between a western character and an east asian wide character are rendered as a newline", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言ったa\nんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言ったa\nんです

", + }, + t, + ) + + no = 5 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between an east asian wide character and a western character are rendered as a newline", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言った\nbんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言った\nbんです

", + }, + t, + ) + + // WithHardWraps take precedence over WithEastAsianLineBreaks + markdown = goldmark.New(goldmark.WithRendererOptions( + html.WithHardWraps(), + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions(NewCJK(WithEastAsianLineBreaks())), + ) + no = 6 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "WithHardWraps take precedence over WithEastAsianLineBreaks", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言った\nんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言った
\nんです

", + }, + t, + ) + + // Tests with EastAsianLineBreaksStyleSimple + markdown = goldmark.New(goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewCJK(WithEastAsianLineBreaks()), + Linkify, + ), + ) + no = 7 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "WithEastAsianLineBreaks and linkfy extension", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言った\r\nんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言ったんです

", + }, + t, + ) + no = 8 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between east asian wide characters or punctuations are ignored", + Markdown: "太郎は\\ **「こんにちわ」**\\ と、\r\n言った\r\nんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と、言ったんです

", + }, + t, + ) + no = 9 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between an east asian wide character and a western character are ignored", + Markdown: "私はプログラマーです。\n東京の会社に勤めています。\nGoでWebアプリケーションを開発しています。", + Expected: "

私はプログラマーです。東京の会社に勤めています。\nGoでWebアプリケーションを開発しています。

", + }, + t, + ) + + // Tests with EastAsianLineBreaksCSS3Draft + markdown = goldmark.New(goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewCJK(WithEastAsianLineBreaks(EastAsianLineBreaksCSS3Draft)), + ), + ) + no = 10 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between a western character and an east asian wide character are ignored", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言ったa\nんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言ったaんです

", + }, + t, + ) + + no = 11 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between an east asian wide character and a western character are ignored", + Markdown: "太郎は\\ **「こんにちわ」**\\ と言った\nbんです", + Expected: "

太郎は\\ 「こんにちわ」\\ と言ったbんです

", + }, + t, + ) + + no = 12 + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: no, + Description: "Soft line breaks between an east asian wide character and a western character are ignored", + Markdown: "私はプログラマーです。\n東京の会社に勤めています。\nGoでWebアプリケーションを開発しています。", + Expected: "

私はプログラマーです。東京の会社に勤めています。GoでWebアプリケーションを開発しています。

", + }, + t, + ) + +} diff --git a/extension/definition_list.go b/extension/definition_list.go new file mode 100644 index 0000000..b7a86c0 --- /dev/null +++ b/extension/definition_list.go @@ -0,0 +1,274 @@ +package extension + +import ( + "github.com/yuin/goldmark" + gast "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/extension/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +type definitionListParser struct { +} + +var defaultDefinitionListParser = &definitionListParser{} + +// NewDefinitionListParser return a new parser.BlockParser that +// can parse PHP Markdown Extra Definition lists. +func NewDefinitionListParser() parser.BlockParser { + return defaultDefinitionListParser +} + +func (b *definitionListParser) Trigger() []byte { + return []byte{':'} +} + +func (b *definitionListParser) Open(parent gast.Node, reader text.Reader, pc parser.Context) (gast.Node, parser.State) { + if _, ok := parent.(*ast.DefinitionList); ok { + return nil, parser.NoChildren + } + line, _ := reader.PeekLine() + pos := pc.BlockOffset() + indent := pc.BlockIndent() + if pos < 0 || line[pos] != ':' || indent != 0 { + return nil, parser.NoChildren + } + + last := parent.LastChild() + // need 1 or more spaces after ':' + w, _ := util.IndentWidth(line[pos+1:], pos+1) + if w < 1 { + return nil, parser.NoChildren + } + if w >= 8 { // starts with indented code + w = 5 + } + w += pos + 1 /* 1 = ':' */ + + para, lastIsParagraph := last.(*gast.Paragraph) + var list *ast.DefinitionList + status := parser.HasChildren + var ok bool + if lastIsParagraph { + list, ok = last.PreviousSibling().(*ast.DefinitionList) + if ok { // is not first item + list.Offset = w + list.TemporaryParagraph = para + } else { // is first item + list = ast.NewDefinitionList(w, para) + status |= parser.RequireParagraph + } + } else if list, ok = last.(*ast.DefinitionList); ok { // multiple description + list.Offset = w + list.TemporaryParagraph = nil + } else { + return nil, parser.NoChildren + } + + return list, status +} + +func (b *definitionListParser) Continue(node gast.Node, reader text.Reader, pc parser.Context) parser.State { + line, _ := reader.PeekLine() + if util.IsBlank(line) { + return parser.Continue | parser.HasChildren + } + list, _ := node.(*ast.DefinitionList) + w, _ := util.IndentWidth(line, reader.LineOffset()) + if w < list.Offset { + return parser.Close + } + pos, padding := util.IndentPosition(line, reader.LineOffset(), list.Offset) + reader.AdvanceAndSetPadding(pos, padding) + return parser.Continue | parser.HasChildren +} + +func (b *definitionListParser) Close(node gast.Node, reader text.Reader, pc parser.Context) { + // nothing to do +} + +func (b *definitionListParser) CanInterruptParagraph() bool { + return true +} + +func (b *definitionListParser) CanAcceptIndentedLine() bool { + return false +} + +type definitionDescriptionParser struct { +} + +var defaultDefinitionDescriptionParser = &definitionDescriptionParser{} + +// NewDefinitionDescriptionParser return a new parser.BlockParser that +// can parse definition description starts with ':'. +func NewDefinitionDescriptionParser() parser.BlockParser { + return defaultDefinitionDescriptionParser +} + +func (b *definitionDescriptionParser) Trigger() []byte { + return []byte{':'} +} + +func (b *definitionDescriptionParser) Open( + parent gast.Node, reader text.Reader, pc parser.Context) (gast.Node, parser.State) { + line, _ := reader.PeekLine() + pos := pc.BlockOffset() + indent := pc.BlockIndent() + if pos < 0 || line[pos] != ':' || indent != 0 { + return nil, parser.NoChildren + } + list, _ := parent.(*ast.DefinitionList) + if list == nil { + return nil, parser.NoChildren + } + para := list.TemporaryParagraph + list.TemporaryParagraph = nil + if para != nil { + lines := para.Lines() + l := lines.Len() + for i := range l { + term := ast.NewDefinitionTerm() + segment := lines.At(i) + term.Lines().Append(segment.TrimRightSpace(reader.Source())) + list.AppendChild(list, term) + } + para.Parent().RemoveChild(para.Parent(), para) + } + cpos, padding := util.IndentPosition(line[pos+1:], pos+1, list.Offset-pos-1) + reader.AdvanceAndSetPadding(cpos+1, padding) + + return ast.NewDefinitionDescription(), parser.HasChildren +} + +func (b *definitionDescriptionParser) Continue(node gast.Node, reader text.Reader, pc parser.Context) parser.State { + // definitionListParser detects end of the description. + // so this method will never be called. + return parser.Continue | parser.HasChildren +} + +func (b *definitionDescriptionParser) Close(node gast.Node, reader text.Reader, pc parser.Context) { + desc := node.(*ast.DefinitionDescription) + desc.IsTight = !desc.HasBlankPreviousLines() + if desc.IsTight { + for gc := desc.FirstChild(); gc != nil; gc = gc.NextSibling() { + paragraph, ok := gc.(*gast.Paragraph) + if ok { + textBlock := gast.NewTextBlock() + textBlock.SetLines(paragraph.Lines()) + desc.ReplaceChild(desc, paragraph, textBlock) + } + } + } +} + +func (b *definitionDescriptionParser) CanInterruptParagraph() bool { + return true +} + +func (b *definitionDescriptionParser) CanAcceptIndentedLine() bool { + return false +} + +// DefinitionListHTMLRenderer is a renderer.NodeRenderer implementation that +// renders DefinitionList nodes. +type DefinitionListHTMLRenderer struct { + html.Config +} + +// NewDefinitionListHTMLRenderer returns a new DefinitionListHTMLRenderer. +func NewDefinitionListHTMLRenderer(opts ...html.Option) renderer.NodeRenderer { + r := &DefinitionListHTMLRenderer{ + Config: html.NewConfig(), + } + for _, opt := range opts { + opt.SetHTMLOption(&r.Config) + } + return r +} + +// RegisterFuncs implements renderer.NodeRenderer.RegisterFuncs. +func (r *DefinitionListHTMLRenderer) RegisterFuncs(reg renderer.NodeRendererFuncRegisterer) { + reg.Register(ast.KindDefinitionList, r.renderDefinitionList) + reg.Register(ast.KindDefinitionTerm, r.renderDefinitionTerm) + reg.Register(ast.KindDefinitionDescription, r.renderDefinitionDescription) +} + +// DefinitionListAttributeFilter defines attribute names which dl elements can have. +var DefinitionListAttributeFilter = html.GlobalAttributeFilter + +func (r *DefinitionListHTMLRenderer) renderDefinitionList( + w util.BufWriter, source []byte, n gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + if n.Attributes() != nil { + _, _ = w.WriteString("\n") + } else { + _, _ = w.WriteString("
\n") + } + } else { + _, _ = w.WriteString("
\n") + } + return gast.WalkContinue, nil +} + +// DefinitionTermAttributeFilter defines attribute names which dd elements can have. +var DefinitionTermAttributeFilter = html.GlobalAttributeFilter + +func (r *DefinitionListHTMLRenderer) renderDefinitionTerm( + w util.BufWriter, source []byte, n gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + if n.Attributes() != nil { + _, _ = w.WriteString("') + } else { + _, _ = w.WriteString("
") + } + } else { + _, _ = w.WriteString("
\n") + } + return gast.WalkContinue, nil +} + +// DefinitionDescriptionAttributeFilter defines attribute names which dd elements can have. +var DefinitionDescriptionAttributeFilter = html.GlobalAttributeFilter + +func (r *DefinitionListHTMLRenderer) renderDefinitionDescription( + w util.BufWriter, source []byte, node gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + n := node.(*ast.DefinitionDescription) + _, _ = w.WriteString("") + } else { + _, _ = w.WriteString(">\n") + } + } else { + _, _ = w.WriteString("\n") + } + return gast.WalkContinue, nil +} + +type definitionList struct { +} + +// DefinitionList is an extension that allow you to use PHP Markdown Extra Definition lists. +var DefinitionList = &definitionList{} + +func (e *definitionList) Extend(m goldmark.Markdown) { + m.Parser().AddOptions(parser.WithBlockParsers( + util.Prioritized(NewDefinitionListParser(), 101), + util.Prioritized(NewDefinitionDescriptionParser(), 102), + )) + m.Renderer().AddOptions(renderer.WithNodeRenderers( + util.Prioritized(NewDefinitionListHTMLRenderer(), 500), + )) +} diff --git a/extension/definition_list_test.go b/extension/definition_list_test.go new file mode 100644 index 0000000..d9dfa6c --- /dev/null +++ b/extension/definition_list_test.go @@ -0,0 +1,21 @@ +package extension + +import ( + "testing" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" +) + +func TestDefinitionList(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + DefinitionList, + ), + ) + testutil.DoTestCaseFile(markdown, "_test/definition_list.txt", t, testutil.ParseCliCaseArg()...) +} diff --git a/extension/footnote.go b/extension/footnote.go new file mode 100644 index 0000000..30eb85c --- /dev/null +++ b/extension/footnote.go @@ -0,0 +1,691 @@ +package extension + +import ( + "bytes" + "fmt" + "strconv" + + "github.com/yuin/goldmark" + gast "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/extension/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +var footnoteListKey = parser.NewContextKey() +var footnoteLinkListKey = parser.NewContextKey() + +type footnoteBlockParser struct { +} + +var defaultFootnoteBlockParser = &footnoteBlockParser{} + +// NewFootnoteBlockParser returns a new parser.BlockParser that can parse +// footnotes of the Markdown(PHP Markdown Extra) text. +func NewFootnoteBlockParser() parser.BlockParser { + return defaultFootnoteBlockParser +} + +func (b *footnoteBlockParser) Trigger() []byte { + return []byte{'['} +} + +func (b *footnoteBlockParser) Open(parent gast.Node, reader text.Reader, pc parser.Context) (gast.Node, parser.State) { + line, segment := reader.PeekLine() + pos := pc.BlockOffset() + if pos < 0 || line[pos] != '[' { + return nil, parser.NoChildren + } + pos++ + if pos > len(line)-1 || line[pos] != '^' { + return nil, parser.NoChildren + } + open := pos + 1 + var closes int + closure := util.FindClosure(line[pos+1:], '[', ']', false, false) //nolint:staticcheck + closes = pos + 1 + closure + next := closes + 1 + if closure > -1 { + if next >= len(line) || line[next] != ':' { + return nil, parser.NoChildren + } + } else { + return nil, parser.NoChildren + } + padding := segment.Padding + label := reader.Value(text.NewSegment(segment.Start+open-padding, segment.Start+closes-padding)) + if util.IsBlank(label) { + return nil, parser.NoChildren + } + item := ast.NewFootnote(label) + + pos = next + 1 - padding + if pos >= len(line) { + reader.Advance(pos) + return item, parser.NoChildren + } + reader.AdvanceAndSetPadding(pos, padding) + return item, parser.HasChildren +} + +func (b *footnoteBlockParser) Continue(node gast.Node, reader text.Reader, pc parser.Context) parser.State { + line, _ := reader.PeekLine() + if util.IsBlank(line) { + return parser.Continue | parser.HasChildren + } + childpos, padding := util.IndentPosition(line, reader.LineOffset(), 4) + if childpos < 0 { + return parser.Close + } + reader.AdvanceAndSetPadding(childpos, padding) + return parser.Continue | parser.HasChildren +} + +func (b *footnoteBlockParser) Close(node gast.Node, reader text.Reader, pc parser.Context) { + var list *ast.FootnoteList + if tlist := pc.Get(footnoteListKey); tlist != nil { + list = tlist.(*ast.FootnoteList) + } else { + list = ast.NewFootnoteList() + pc.Set(footnoteListKey, list) + node.Parent().InsertBefore(node.Parent(), node, list) + } + node.Parent().RemoveChild(node.Parent(), node) + list.AppendChild(list, node) +} + +func (b *footnoteBlockParser) CanInterruptParagraph() bool { + return true +} + +func (b *footnoteBlockParser) CanAcceptIndentedLine() bool { + return false +} + +type footnoteParser struct { +} + +var defaultFootnoteParser = &footnoteParser{} + +// NewFootnoteParser returns a new parser.InlineParser that can parse +// footnote links of the Markdown(PHP Markdown Extra) text. +func NewFootnoteParser() parser.InlineParser { + return defaultFootnoteParser +} + +func (s *footnoteParser) Trigger() []byte { + // footnote syntax probably conflict with the image syntax. + // So we need trigger this parser with '!'. + return []byte{'!', '['} +} + +func (s *footnoteParser) Parse(parent gast.Node, block text.Reader, pc parser.Context) gast.Node { + line, segment := block.PeekLine() + pos := 1 + if len(line) > 0 && line[0] == '!' { + pos++ + } + if pos >= len(line) || line[pos] != '^' { + return nil + } + pos++ + if pos >= len(line) { + return nil + } + open := pos + closure := util.FindClosure(line[pos:], '[', ']', false, false) //nolint:staticcheck + if closure < 0 { + return nil + } + closes := pos + closure + value := block.Value(text.NewSegment(segment.Start+open, segment.Start+closes)) + block.Advance(closes + 1) + + var list *ast.FootnoteList + if tlist := pc.Get(footnoteListKey); tlist != nil { + list = tlist.(*ast.FootnoteList) + } + if list == nil { + return nil + } + index := 0 + for def := list.FirstChild(); def != nil; def = def.NextSibling() { + d := def.(*ast.Footnote) + if bytes.Equal(d.Ref, value) { + if d.Index < 0 { + list.Count++ + d.Index = list.Count + } + index = d.Index + break + } + } + if index == 0 { + return nil + } + + fnlink := ast.NewFootnoteLink(index) + var fnlist []*ast.FootnoteLink + if tmp := pc.Get(footnoteLinkListKey); tmp != nil { + fnlist = tmp.([]*ast.FootnoteLink) + } else { + fnlist = []*ast.FootnoteLink{} + pc.Set(footnoteLinkListKey, fnlist) + } + pc.Set(footnoteLinkListKey, append(fnlist, fnlink)) + if line[0] == '!' { + parent.AppendChild(parent, gast.NewTextSegment(text.NewSegment(segment.Start, segment.Start+1))) + } + + return fnlink +} + +type footnoteASTTransformer struct { +} + +var defaultFootnoteASTTransformer = &footnoteASTTransformer{} + +// NewFootnoteASTTransformer returns a new parser.ASTTransformer that +// insert a footnote list to the last of the document. +func NewFootnoteASTTransformer() parser.ASTTransformer { + return defaultFootnoteASTTransformer +} + +func (a *footnoteASTTransformer) Transform(node *gast.Document, reader text.Reader, pc parser.Context) { + var list *ast.FootnoteList + var fnlist []*ast.FootnoteLink + if tmp := pc.Get(footnoteListKey); tmp != nil { + list = tmp.(*ast.FootnoteList) + } + if tmp := pc.Get(footnoteLinkListKey); tmp != nil { + fnlist = tmp.([]*ast.FootnoteLink) + } + + pc.Set(footnoteListKey, nil) + pc.Set(footnoteLinkListKey, nil) + + if list == nil { + return + } + + counter := map[int]int{} + if fnlist != nil { + for _, fnlink := range fnlist { + if fnlink.Index >= 0 { + counter[fnlink.Index]++ + } + } + refCounter := map[int]int{} + for _, fnlink := range fnlist { + fnlink.RefCount = counter[fnlink.Index] + if _, ok := refCounter[fnlink.Index]; !ok { + refCounter[fnlink.Index] = 0 + } + fnlink.RefIndex = refCounter[fnlink.Index] + refCounter[fnlink.Index]++ + } + } + for footnote := list.FirstChild(); footnote != nil; { + var container gast.Node = footnote + next := footnote.NextSibling() + if fc := container.LastChild(); fc != nil && gast.IsParagraph(fc) { + container = fc + } + fn := footnote.(*ast.Footnote) + index := fn.Index + if index < 0 { + list.RemoveChild(list, footnote) + } else { + refCount := counter[index] + backLink := ast.NewFootnoteBacklink(index) + backLink.RefCount = refCount + backLink.RefIndex = 0 + container.AppendChild(container, backLink) + if refCount > 1 { + for i := 1; i < refCount; i++ { + backLink := ast.NewFootnoteBacklink(index) + backLink.RefCount = refCount + backLink.RefIndex = i + container.AppendChild(container, backLink) + } + } + } + footnote = next + } + list.SortChildren(func(n1, n2 gast.Node) int { + if n1.(*ast.Footnote).Index < n2.(*ast.Footnote).Index { + return -1 + } + return 1 + }) + if list.Count <= 0 { + list.Parent().RemoveChild(list.Parent(), list) + return + } + + node.AppendChild(node, list) +} + +// FootnoteConfig holds configuration values for the footnote extension. +// +// Link* and Backlink* configurations have some variables: +// Occurrences of “^^” in the string will be replaced by the +// corresponding footnote number in the HTML output. +// Occurrences of “%%” will be replaced by a number for the +// reference (footnotes can have multiple references). +type FootnoteConfig struct { + html.Config + + // IDPrefix is a prefix for the id attributes generated by footnotes. + IDPrefix []byte + + // IDPrefix is a function that determines the id attribute for given Node. + IDPrefixFunction func(gast.Node) []byte + + // LinkTitle is an optional title attribute for footnote links. + LinkTitle []byte + + // BacklinkTitle is an optional title attribute for footnote backlinks. + BacklinkTitle []byte + + // LinkClass is a class for footnote links. + LinkClass []byte + + // BacklinkClass is a class for footnote backlinks. + BacklinkClass []byte + + // BacklinkHTML is an HTML content for footnote backlinks. + BacklinkHTML []byte +} + +// FootnoteOption interface is a functional option interface for the extension. +type FootnoteOption interface { + renderer.Option + // SetFootnoteOption sets given option to the extension. + SetFootnoteOption(*FootnoteConfig) +} + +// NewFootnoteConfig returns a new Config with defaults. +func NewFootnoteConfig() FootnoteConfig { + return FootnoteConfig{ + Config: html.NewConfig(), + LinkTitle: []byte(""), + BacklinkTitle: []byte(""), + LinkClass: []byte("footnote-ref"), + BacklinkClass: []byte("footnote-backref"), + BacklinkHTML: []byte("↩︎"), + } +} + +// SetOption implements renderer.SetOptioner. +func (c *FootnoteConfig) SetOption(name renderer.OptionName, value any) { + switch name { + case optFootnoteIDPrefixFunction: + c.IDPrefixFunction = value.(func(gast.Node) []byte) + case optFootnoteIDPrefix: + c.IDPrefix = value.([]byte) + case optFootnoteLinkTitle: + c.LinkTitle = value.([]byte) + case optFootnoteBacklinkTitle: + c.BacklinkTitle = value.([]byte) + case optFootnoteLinkClass: + c.LinkClass = value.([]byte) + case optFootnoteBacklinkClass: + c.BacklinkClass = value.([]byte) + case optFootnoteBacklinkHTML: + c.BacklinkHTML = value.([]byte) + default: + c.Config.SetOption(name, value) + } +} + +type withFootnoteHTMLOptions struct { + value []html.Option +} + +func (o *withFootnoteHTMLOptions) SetConfig(c *renderer.Config) { + if o.value != nil { + for _, v := range o.value { + v.(renderer.Option).SetConfig(c) + } + } +} + +func (o *withFootnoteHTMLOptions) SetFootnoteOption(c *FootnoteConfig) { + if o.value != nil { + for _, v := range o.value { + v.SetHTMLOption(&c.Config) + } + } +} + +// WithFootnoteHTMLOptions is functional option that wraps goldmark HTMLRenderer options. +func WithFootnoteHTMLOptions(opts ...html.Option) FootnoteOption { + return &withFootnoteHTMLOptions{opts} +} + +const optFootnoteIDPrefix renderer.OptionName = "FootnoteIDPrefix" + +type withFootnoteIDPrefix struct { + value []byte +} + +func (o *withFootnoteIDPrefix) SetConfig(c *renderer.Config) { + c.Options[optFootnoteIDPrefix] = o.value +} + +func (o *withFootnoteIDPrefix) SetFootnoteOption(c *FootnoteConfig) { + c.IDPrefix = o.value +} + +// WithFootnoteIDPrefix is a functional option that is a prefix for the id attributes generated by footnotes. +func WithFootnoteIDPrefix[T []byte | string](a T) FootnoteOption { + return &withFootnoteIDPrefix{[]byte(a)} +} + +const optFootnoteIDPrefixFunction renderer.OptionName = "FootnoteIDPrefixFunction" + +type withFootnoteIDPrefixFunction struct { + value func(gast.Node) []byte +} + +func (o *withFootnoteIDPrefixFunction) SetConfig(c *renderer.Config) { + c.Options[optFootnoteIDPrefixFunction] = o.value +} + +func (o *withFootnoteIDPrefixFunction) SetFootnoteOption(c *FootnoteConfig) { + c.IDPrefixFunction = o.value +} + +// WithFootnoteIDPrefixFunction is a functional option that is a prefix for the id attributes generated by footnotes. +func WithFootnoteIDPrefixFunction(a func(gast.Node) []byte) FootnoteOption { + return &withFootnoteIDPrefixFunction{a} +} + +const optFootnoteLinkTitle renderer.OptionName = "FootnoteLinkTitle" + +type withFootnoteLinkTitle struct { + value []byte +} + +func (o *withFootnoteLinkTitle) SetConfig(c *renderer.Config) { + c.Options[optFootnoteLinkTitle] = o.value +} + +func (o *withFootnoteLinkTitle) SetFootnoteOption(c *FootnoteConfig) { + c.LinkTitle = o.value +} + +// WithFootnoteLinkTitle is a functional option that is an optional title attribute for footnote links. +func WithFootnoteLinkTitle[T []byte | string](a T) FootnoteOption { + return &withFootnoteLinkTitle{[]byte(a)} +} + +const optFootnoteBacklinkTitle renderer.OptionName = "FootnoteBacklinkTitle" + +type withFootnoteBacklinkTitle struct { + value []byte +} + +func (o *withFootnoteBacklinkTitle) SetConfig(c *renderer.Config) { + c.Options[optFootnoteBacklinkTitle] = o.value +} + +func (o *withFootnoteBacklinkTitle) SetFootnoteOption(c *FootnoteConfig) { + c.BacklinkTitle = o.value +} + +// WithFootnoteBacklinkTitle is a functional option that is an optional title attribute for footnote backlinks. +func WithFootnoteBacklinkTitle[T []byte | string](a T) FootnoteOption { + return &withFootnoteBacklinkTitle{[]byte(a)} +} + +const optFootnoteLinkClass renderer.OptionName = "FootnoteLinkClass" + +type withFootnoteLinkClass struct { + value []byte +} + +func (o *withFootnoteLinkClass) SetConfig(c *renderer.Config) { + c.Options[optFootnoteLinkClass] = o.value +} + +func (o *withFootnoteLinkClass) SetFootnoteOption(c *FootnoteConfig) { + c.LinkClass = o.value +} + +// WithFootnoteLinkClass is a functional option that is a class for footnote links. +func WithFootnoteLinkClass[T []byte | string](a T) FootnoteOption { + return &withFootnoteLinkClass{[]byte(a)} +} + +const optFootnoteBacklinkClass renderer.OptionName = "FootnoteBacklinkClass" + +type withFootnoteBacklinkClass struct { + value []byte +} + +func (o *withFootnoteBacklinkClass) SetConfig(c *renderer.Config) { + c.Options[optFootnoteBacklinkClass] = o.value +} + +func (o *withFootnoteBacklinkClass) SetFootnoteOption(c *FootnoteConfig) { + c.BacklinkClass = o.value +} + +// WithFootnoteBacklinkClass is a functional option that is a class for footnote backlinks. +func WithFootnoteBacklinkClass[T []byte | string](a T) FootnoteOption { + return &withFootnoteBacklinkClass{[]byte(a)} +} + +const optFootnoteBacklinkHTML renderer.OptionName = "FootnoteBacklinkHTML" + +type withFootnoteBacklinkHTML struct { + value []byte +} + +func (o *withFootnoteBacklinkHTML) SetConfig(c *renderer.Config) { + c.Options[optFootnoteBacklinkHTML] = o.value +} + +func (o *withFootnoteBacklinkHTML) SetFootnoteOption(c *FootnoteConfig) { + c.BacklinkHTML = o.value +} + +// WithFootnoteBacklinkHTML is an HTML content for footnote backlinks. +func WithFootnoteBacklinkHTML[T []byte | string](a T) FootnoteOption { + return &withFootnoteBacklinkHTML{[]byte(a)} +} + +// FootnoteHTMLRenderer is a renderer.NodeRenderer implementation that +// renders FootnoteLink nodes. +type FootnoteHTMLRenderer struct { + FootnoteConfig +} + +// NewFootnoteHTMLRenderer returns a new FootnoteHTMLRenderer. +func NewFootnoteHTMLRenderer(opts ...FootnoteOption) renderer.NodeRenderer { + r := &FootnoteHTMLRenderer{ + FootnoteConfig: NewFootnoteConfig(), + } + for _, opt := range opts { + opt.SetFootnoteOption(&r.FootnoteConfig) + } + return r +} + +// RegisterFuncs implements renderer.NodeRenderer.RegisterFuncs. +func (r *FootnoteHTMLRenderer) RegisterFuncs(reg renderer.NodeRendererFuncRegisterer) { + reg.Register(ast.KindFootnoteLink, r.renderFootnoteLink) + reg.Register(ast.KindFootnoteBacklink, r.renderFootnoteBacklink) + reg.Register(ast.KindFootnote, r.renderFootnote) + reg.Register(ast.KindFootnoteList, r.renderFootnoteList) +} + +func (r *FootnoteHTMLRenderer) renderFootnoteLink( + w util.BufWriter, source []byte, node gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + n := node.(*ast.FootnoteLink) + is := strconv.Itoa(n.Index) + _, _ = w.WriteString(``) + + _, _ = w.WriteString(is) + _, _ = w.WriteString(``) + } + return gast.WalkContinue, nil +} + +func (r *FootnoteHTMLRenderer) renderFootnoteBacklink( + w util.BufWriter, source []byte, node gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + n := node.(*ast.FootnoteBacklink) + is := strconv.Itoa(n.Index) + _, _ = w.WriteString(` `) + _, _ = w.Write(applyFootnoteTemplate(r.FootnoteConfig.BacklinkHTML, n.Index, n.RefCount)) + _, _ = w.WriteString(``) + } + return gast.WalkContinue, nil +} + +func (r *FootnoteHTMLRenderer) renderFootnote( + w util.BufWriter, source []byte, node gast.Node, entering bool) (gast.WalkStatus, error) { + n := node.(*ast.Footnote) + is := strconv.Itoa(n.Index) + if entering { + _, _ = w.WriteString(`
  • \n") + } else { + _, _ = w.WriteString("
  • \n") + } + return gast.WalkContinue, nil +} + +func (r *FootnoteHTMLRenderer) renderFootnoteList( + w util.BufWriter, source []byte, node gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + _, _ = w.WriteString(`
    ') + if r.Config.XHTML { + _, _ = w.WriteString("\n
    \n") + } else { + _, _ = w.WriteString("\n
    \n") + } + _, _ = w.WriteString("
      \n") + } else { + _, _ = w.WriteString("
    \n") + _, _ = w.WriteString("
    \n") + } + return gast.WalkContinue, nil +} + +func (r *FootnoteHTMLRenderer) idPrefix(node gast.Node) []byte { + if r.FootnoteConfig.IDPrefix != nil { + return r.FootnoteConfig.IDPrefix + } + if r.FootnoteConfig.IDPrefixFunction != nil { + return r.FootnoteConfig.IDPrefixFunction(node) + } + return []byte("") +} + +func applyFootnoteTemplate(b []byte, index, refCount int) []byte { + fast := true + for i, c := range b { + if i != 0 { + if b[i-1] == '^' && c == '^' { + fast = false + break + } + if b[i-1] == '%' && c == '%' { + fast = false + break + } + } + } + if fast { + return b + } + is := []byte(strconv.Itoa(index)) + rs := []byte(strconv.Itoa(refCount)) + ret := bytes.Replace(b, []byte("^^"), is, -1) + return bytes.Replace(ret, []byte("%%"), rs, -1) +} + +type footnote struct { + options []FootnoteOption +} + +// Footnote is an extension that allow you to use PHP Markdown Extra Footnotes. +var Footnote = &footnote{ + options: []FootnoteOption{}, +} + +// NewFootnote returns a new extension with given options. +func NewFootnote(opts ...FootnoteOption) goldmark.Extender { + return &footnote{ + options: opts, + } +} + +func (e *footnote) Extend(m goldmark.Markdown) { + m.Parser().AddOptions( + parser.WithBlockParsers( + util.Prioritized(NewFootnoteBlockParser(), 999), + ), + parser.WithInlineParsers( + util.Prioritized(NewFootnoteParser(), 101), + ), + parser.WithASTTransformers( + util.Prioritized(NewFootnoteASTTransformer(), 999), + ), + ) + m.Renderer().AddOptions(renderer.WithNodeRenderers( + util.Prioritized(NewFootnoteHTMLRenderer(e.options...), 500), + )) +} diff --git a/extension/footnote_test.go b/extension/footnote_test.go new file mode 100644 index 0000000..af22443 --- /dev/null +++ b/extension/footnote_test.go @@ -0,0 +1,141 @@ +package extension + +import ( + "testing" + + "github.com/yuin/goldmark" + gast "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +func TestFootnote(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + Footnote, + ), + ) + testutil.DoTestCaseFile(markdown, "_test/footnote.txt", t, testutil.ParseCliCaseArg()...) +} + +type footnoteID struct { +} + +func (a *footnoteID) Transform(node *gast.Document, reader text.Reader, pc parser.Context) { + node.Meta()["footnote-prefix"] = "article12-" +} + +func TestFootnoteOptions(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewFootnote( + WithFootnoteIDPrefix("article12-"), + WithFootnoteLinkClass("link-class"), + WithFootnoteBacklinkClass("backlink-class"), + WithFootnoteLinkTitle("link-title-%%-^^"), + WithFootnoteBacklinkTitle("backlink-title"), + WithFootnoteBacklinkHTML("^"), + ), + ), + ) + + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Description: "Footnote with options", + Markdown: `That's some text with a footnote.[^1] + +Same footnote.[^1] + +Another one.[^2] + +[^1]: And that's the footnote. +[^2]: Another footnote. +`, + Expected: `

    That's some text with a footnote.1

    +

    Same footnote.1

    +

    Another one.2

    +
    +
    +
      +
    1. +

      And that's the footnote. ^ ^

      +
    2. +
    3. +

      Another footnote. ^

      +
    4. +
    +
    `, + }, + t, + ) + + markdown = goldmark.New( + goldmark.WithParserOptions( + parser.WithASTTransformers( + util.Prioritized(&footnoteID{}, 100), + ), + ), + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewFootnote( + WithFootnoteIDPrefixFunction(func(n gast.Node) []byte { + v, ok := n.OwnerDocument().Meta()["footnote-prefix"] + if ok { + return util.StringToReadOnlyBytes(v.(string)) + } + return nil + }), + WithFootnoteLinkClass([]byte("link-class")), + WithFootnoteBacklinkClass([]byte("backlink-class")), + WithFootnoteLinkTitle([]byte("link-title-%%-^^")), + WithFootnoteBacklinkTitle([]byte("backlink-title")), + WithFootnoteBacklinkHTML([]byte("^")), + ), + ), + ) + + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 2, + Description: "Footnote with an id prefix function", + Markdown: `That's some text with a footnote.[^1] + +Same footnote.[^1] + +Another one.[^2] + +[^1]: And that's the footnote. +[^2]: Another footnote. +`, + Expected: `

    That's some text with a footnote.1

    +

    Same footnote.1

    +

    Another one.2

    +
    +
    +
      +
    1. +

      And that's the footnote. ^ ^

      +
    2. +
    3. +

      Another footnote. ^

      +
    4. +
    +
    `, + }, + t, + ) +} diff --git a/extension/gfm.go b/extension/gfm.go new file mode 100644 index 0000000..a570fbd --- /dev/null +++ b/extension/gfm.go @@ -0,0 +1,18 @@ +package extension + +import ( + "github.com/yuin/goldmark" +) + +type gfm struct { +} + +// GFM is an extension that provides Github Flavored markdown functionalities. +var GFM = &gfm{} + +func (e *gfm) Extend(m goldmark.Markdown) { + Linkify.Extend(m) + Table.Extend(m) + Strikethrough.Extend(m) + TaskList.Extend(m) +} diff --git a/extension/linkify.go b/extension/linkify.go new file mode 100644 index 0000000..f76e31d --- /dev/null +++ b/extension/linkify.go @@ -0,0 +1,323 @@ +package extension + +import ( + "bytes" + "regexp" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +var wwwURLRegxp = regexp.MustCompile(`^www\.[-a-zA-Z0-9@:%._\+~#=]{1,256}\.[a-z]+(?:[/#?][-a-zA-Z0-9@:%_\+.~#!?&/=\(\);,'">\^{}\[\]` + "`" + `]*)?`) //nolint:golint,lll + +var urlRegexp = regexp.MustCompile(`^(?:http|https|ftp)://[-a-zA-Z0-9@:%._\+~#=]{1,256}\.[a-z]+(?::\d+)?(?:[/#?][-a-zA-Z0-9@:%_+.~#$!?&/=\(\);,'">\^{}\[\]` + "`" + `]*)?`) //nolint:golint,lll + +// An LinkifyConfig struct is a data structure that holds configuration of the +// Linkify extension. +type LinkifyConfig struct { + AllowedProtocols [][]byte + URLRegexp *regexp.Regexp + WWWRegexp *regexp.Regexp + EmailRegexp *regexp.Regexp +} + +const ( + optLinkifyAllowedProtocols parser.OptionName = "LinkifyAllowedProtocols" + optLinkifyURLRegexp parser.OptionName = "LinkifyURLRegexp" + optLinkifyWWWRegexp parser.OptionName = "LinkifyWWWRegexp" + optLinkifyEmailRegexp parser.OptionName = "LinkifyEmailRegexp" +) + +// SetOption implements SetOptioner. +func (c *LinkifyConfig) SetOption(name parser.OptionName, value any) { + switch name { + case optLinkifyAllowedProtocols: + c.AllowedProtocols = value.([][]byte) + case optLinkifyURLRegexp: + c.URLRegexp = value.(*regexp.Regexp) + case optLinkifyWWWRegexp: + c.WWWRegexp = value.(*regexp.Regexp) + case optLinkifyEmailRegexp: + c.EmailRegexp = value.(*regexp.Regexp) + } +} + +// A LinkifyOption interface sets options for the LinkifyOption. +type LinkifyOption interface { + parser.Option + SetLinkifyOption(*LinkifyConfig) +} + +type withLinkifyAllowedProtocols struct { + value [][]byte +} + +func (o *withLinkifyAllowedProtocols) SetParserOption(c *parser.Config) { + c.Options[optLinkifyAllowedProtocols] = o.value +} + +func (o *withLinkifyAllowedProtocols) SetLinkifyOption(p *LinkifyConfig) { + p.AllowedProtocols = o.value +} + +// WithLinkifyAllowedProtocols is a functional option that specify allowed +// protocols in autolinks. Each protocol must end with ':' like +// 'http:' . +func WithLinkifyAllowedProtocols[T []byte | string](value []T) LinkifyOption { + opt := &withLinkifyAllowedProtocols{} + for _, v := range value { + opt.value = append(opt.value, []byte(v)) + } + return opt +} + +type withLinkifyURLRegexp struct { + value *regexp.Regexp +} + +func (o *withLinkifyURLRegexp) SetParserOption(c *parser.Config) { + c.Options[optLinkifyURLRegexp] = o.value +} + +func (o *withLinkifyURLRegexp) SetLinkifyOption(p *LinkifyConfig) { + p.URLRegexp = o.value +} + +// WithLinkifyURLRegexp is a functional option that specify +// a pattern of the URL including a protocol. +func WithLinkifyURLRegexp(value *regexp.Regexp) LinkifyOption { + return &withLinkifyURLRegexp{ + value: value, + } +} + +type withLinkifyWWWRegexp struct { + value *regexp.Regexp +} + +func (o *withLinkifyWWWRegexp) SetParserOption(c *parser.Config) { + c.Options[optLinkifyWWWRegexp] = o.value +} + +func (o *withLinkifyWWWRegexp) SetLinkifyOption(p *LinkifyConfig) { + p.WWWRegexp = o.value +} + +// WithLinkifyWWWRegexp is a functional option that specify +// a pattern of the URL without a protocol. +// This pattern must start with 'www.' . +func WithLinkifyWWWRegexp(value *regexp.Regexp) LinkifyOption { + return &withLinkifyWWWRegexp{ + value: value, + } +} + +type withLinkifyEmailRegexp struct { + value *regexp.Regexp +} + +func (o *withLinkifyEmailRegexp) SetParserOption(c *parser.Config) { + c.Options[optLinkifyEmailRegexp] = o.value +} + +func (o *withLinkifyEmailRegexp) SetLinkifyOption(p *LinkifyConfig) { + p.EmailRegexp = o.value +} + +// WithLinkifyEmailRegexp is a functional otpion that specify +// a pattern of the email address. +func WithLinkifyEmailRegexp(value *regexp.Regexp) LinkifyOption { + return &withLinkifyEmailRegexp{ + value: value, + } +} + +type linkifyParser struct { + LinkifyConfig +} + +// NewLinkifyParser return a new InlineParser can parse +// text that seems like a URL. +func NewLinkifyParser(opts ...LinkifyOption) parser.InlineParser { + p := &linkifyParser{ + LinkifyConfig: LinkifyConfig{ + AllowedProtocols: nil, + URLRegexp: urlRegexp, + WWWRegexp: wwwURLRegxp, + }, + } + for _, o := range opts { + o.SetLinkifyOption(&p.LinkifyConfig) + } + return p +} + +func (s *linkifyParser) Trigger() []byte { + // ' ' indicates any white spaces and a line head + return []byte{' ', '*', '_', '~', '('} +} + +var ( + protoHTTP = []byte("http:") + protoHTTPS = []byte("https:") + protoFTP = []byte("ftp:") + domainWWW = []byte("www.") +) + +func (s *linkifyParser) Parse(parent ast.Node, block text.Reader, pc parser.Context) ast.Node { + if pc.IsInLinkLabel() { + return nil + } + line, segment := block.PeekLine() + consumes := 0 + start := segment.Start + c := line[0] + // advance if current position is not a line head. + if c == ' ' || c == '*' || c == '_' || c == '~' || c == '(' { + consumes++ + start++ + line = line[1:] + } + + var m []int + var protocol []byte + var typ ast.AutoLinkType = ast.AutoLinkURL + if s.LinkifyConfig.AllowedProtocols == nil { + if bytes.HasPrefix(line, protoHTTP) || bytes.HasPrefix(line, protoHTTPS) || bytes.HasPrefix(line, protoFTP) { + m = s.LinkifyConfig.URLRegexp.FindSubmatchIndex(line) + } + } else { + for _, prefix := range s.LinkifyConfig.AllowedProtocols { + if bytes.HasPrefix(line, prefix) { + m = s.LinkifyConfig.URLRegexp.FindSubmatchIndex(line) + break + } + } + } + if m == nil && bytes.HasPrefix(line, domainWWW) { + m = s.LinkifyConfig.WWWRegexp.FindSubmatchIndex(line) + protocol = []byte("http") + } + if m != nil && m[0] != 0 { + m = nil + } + if m != nil && m[0] == 0 { + lastChar := line[m[1]-1] + if lastChar == '.' { + m[1]-- + } else if lastChar == ')' { + closing := 0 + for i := m[1] - 1; i >= m[0]; i-- { + switch line[i] { + case ')': + closing++ + case '(': + closing-- + } + } + if closing > 0 { + m[1] -= closing + } + } else if lastChar == ';' { + i := m[1] - 2 + for ; i >= m[0]; i-- { + if util.IsAlphaNumeric(line[i]) { + continue + } + break + } + if i != m[1]-2 { + if line[i] == '&' { + m[1] -= m[1] - i + } + } + } + } + if m == nil { + if len(line) > 0 && util.IsPunct(line[0]) { + return nil + } + typ = ast.AutoLinkEmail + stop := -1 + if s.LinkifyConfig.EmailRegexp == nil { + stop = util.FindEmailIndex(line) + } else { + m := s.LinkifyConfig.EmailRegexp.FindSubmatchIndex(line) + if m != nil && m[0] == 0 { + stop = m[1] + } + } + if stop < 0 { + return nil + } + at := bytes.IndexByte(line, '@') + m = []int{0, stop, at, stop - 1} + if bytes.IndexByte(line[m[2]:m[3]], '.') < 0 { + return nil + } + lastChar := line[m[1]-1] + if lastChar == '.' { + m[1]-- + } + if m[1] < len(line) { + nextChar := line[m[1]] + if nextChar == '-' || nextChar == '_' { + return nil + } + } + } + if m == nil { + return nil + } + if consumes != 0 { + s := segment.WithStop(segment.Start + 1) + ast.MergeOrAppendTextSegment(parent, s) + } + i := m[1] - 1 + for ; i > 0; i-- { + c := line[i] + switch c { + case '?', '!', '.', ',', ':', '*', '_', '~': + default: + goto endfor + } + } +endfor: + i++ + consumes += i + block.Advance(consumes) + n := ast.NewTextSegment(text.NewSegment(start, start+i)) + link := ast.NewAutoLink(typ, n) + link.Protocol = protocol + return link +} + +func (s *linkifyParser) CloseBlock(parent ast.Node, pc parser.Context) { + // nothing to do +} + +type linkify struct { + options []LinkifyOption +} + +// Linkify is an extension that allow you to parse text that seems like a URL. +var Linkify = &linkify{} + +// NewLinkify creates a new [goldmark.Extender] that +// allow you to parse text that seems like a URL. +func NewLinkify(opts ...LinkifyOption) goldmark.Extender { + return &linkify{ + options: opts, + } +} + +func (e *linkify) Extend(m goldmark.Markdown) { + m.Parser().AddOptions( + parser.WithInlineParsers( + util.Prioritized(NewLinkifyParser(e.options...), 999), + ), + ) +} diff --git a/extension/linkify_test.go b/extension/linkify_test.go new file mode 100644 index 0000000..4d70ea4 --- /dev/null +++ b/extension/linkify_test.go @@ -0,0 +1,100 @@ +package extension + +import ( + "regexp" + "testing" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" +) + +func TestLinkify(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + Linkify, + ), + ) + testutil.DoTestCaseFile(markdown, "_test/linkify.txt", t, testutil.ParseCliCaseArg()...) +} + +func TestLinkifyWithAllowedProtocols(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewLinkify( + WithLinkifyAllowedProtocols([]string{ + "ssh:", + }), + WithLinkifyURLRegexp( + regexp.MustCompile(`\w+://[^\s]+`), + ), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Markdown: `hoge ssh://user@hoge.com. http://example.com/`, + Expected: `

    hoge ssh://user@hoge.com. http://example.com/

    `, + }, + t, + ) +} + +func TestLinkifyWithWWWRegexp(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewLinkify( + WithLinkifyWWWRegexp( + regexp.MustCompile(`www\.example\.com`), + ), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Markdown: `www.google.com www.example.com`, + Expected: `

    www.google.com www.example.com

    `, + }, + t, + ) +} + +func TestLinkifyWithEmailRegexp(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewLinkify( + WithLinkifyEmailRegexp( + regexp.MustCompile(`user@example\.com`), + ), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Markdown: `hoge@example.com user@example.com`, + Expected: `

    hoge@example.com user@example.com

    `, + }, + t, + ) +} diff --git a/extension/package.go b/extension/package.go new file mode 100644 index 0000000..2ec1d1e --- /dev/null +++ b/extension/package.go @@ -0,0 +1,2 @@ +// Package extension is a collection of builtin extensions. +package extension diff --git a/extension/strikethrough.go b/extension/strikethrough.go new file mode 100644 index 0000000..9fc0bec --- /dev/null +++ b/extension/strikethrough.go @@ -0,0 +1,118 @@ +package extension + +import ( + "github.com/yuin/goldmark" + gast "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/extension/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +type strikethroughDelimiterProcessor struct { +} + +func (p *strikethroughDelimiterProcessor) IsDelimiter(b byte) bool { + return b == '~' +} + +func (p *strikethroughDelimiterProcessor) CanOpenCloser(opener, closer *parser.Delimiter) bool { + return opener.Char == closer.Char +} + +func (p *strikethroughDelimiterProcessor) OnMatch(consumes int) gast.Node { + return ast.NewStrikethrough() +} + +var defaultStrikethroughDelimiterProcessor = &strikethroughDelimiterProcessor{} + +type strikethroughParser struct { +} + +var defaultStrikethroughParser = &strikethroughParser{} + +// NewStrikethroughParser return a new InlineParser that parses +// strikethrough expressions. +func NewStrikethroughParser() parser.InlineParser { + return defaultStrikethroughParser +} + +func (s *strikethroughParser) Trigger() []byte { + return []byte{'~'} +} + +func (s *strikethroughParser) Parse(parent gast.Node, block text.Reader, pc parser.Context) gast.Node { + before := block.PrecendingCharacter() + line, segment := block.PeekLine() + node := parser.ScanDelimiter(line, before, 1, defaultStrikethroughDelimiterProcessor) + if node == nil || node.OriginalLength > 2 || before == '~' { + return nil + } + + node.Segment = segment.WithStop(segment.Start + node.OriginalLength) + block.Advance(node.OriginalLength) + pc.PushDelimiter(node) + return node +} + +func (s *strikethroughParser) CloseBlock(parent gast.Node, pc parser.Context) { + // nothing to do +} + +// StrikethroughHTMLRenderer is a renderer.NodeRenderer implementation that +// renders Strikethrough nodes. +type StrikethroughHTMLRenderer struct { + html.Config +} + +// NewStrikethroughHTMLRenderer returns a new StrikethroughHTMLRenderer. +func NewStrikethroughHTMLRenderer(opts ...html.Option) renderer.NodeRenderer { + r := &StrikethroughHTMLRenderer{ + Config: html.NewConfig(), + } + for _, opt := range opts { + opt.SetHTMLOption(&r.Config) + } + return r +} + +// RegisterFuncs implements renderer.NodeRenderer.RegisterFuncs. +func (r *StrikethroughHTMLRenderer) RegisterFuncs(reg renderer.NodeRendererFuncRegisterer) { + reg.Register(ast.KindStrikethrough, r.renderStrikethrough) +} + +// StrikethroughAttributeFilter defines attribute names which dd elements can have. +var StrikethroughAttributeFilter = html.GlobalAttributeFilter + +func (r *StrikethroughHTMLRenderer) renderStrikethrough( + w util.BufWriter, source []byte, n gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + if n.Attributes() != nil { + _, _ = w.WriteString("') + } else { + _, _ = w.WriteString("") + } + } else { + _, _ = w.WriteString("") + } + return gast.WalkContinue, nil +} + +type strikethrough struct { +} + +// Strikethrough is an extension that allow you to use strikethrough expression like '~~text~~' . +var Strikethrough = &strikethrough{} + +func (e *strikethrough) Extend(m goldmark.Markdown) { + m.Parser().AddOptions(parser.WithInlineParsers( + util.Prioritized(NewStrikethroughParser(), 500), + )) + m.Renderer().AddOptions(renderer.WithNodeRenderers( + util.Prioritized(NewStrikethroughHTMLRenderer(), 500), + )) +} diff --git a/extension/strikethrough_test.go b/extension/strikethrough_test.go new file mode 100644 index 0000000..3274c0e --- /dev/null +++ b/extension/strikethrough_test.go @@ -0,0 +1,21 @@ +package extension + +import ( + "testing" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" +) + +func TestStrikethrough(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + Strikethrough, + ), + ) + testutil.DoTestCaseFile(markdown, "_test/strikethrough.txt", t, testutil.ParseCliCaseArg()...) +} diff --git a/extension/table.go b/extension/table.go new file mode 100644 index 0000000..1d74182 --- /dev/null +++ b/extension/table.go @@ -0,0 +1,569 @@ +package extension + +import ( + "bytes" + "fmt" + "regexp" + + "github.com/yuin/goldmark" + gast "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/extension/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +var escapedPipeCellListKey = parser.NewContextKey() + +type escapedPipeCell struct { + Cell *ast.TableCell + Pos []int + Transformed bool +} + +// TableCellAlignMethod indicates how are table cells aligned in HTML format. +type TableCellAlignMethod int + +const ( + // TableCellAlignDefault renders alignments by default method. + // With XHTML, alignments are rendered as an align attribute. + // With HTML5, alignments are rendered as a style attribute. + TableCellAlignDefault TableCellAlignMethod = iota + + // TableCellAlignAttribute renders alignments as an align attribute. + TableCellAlignAttribute + + // TableCellAlignStyle renders alignments as a style attribute. + TableCellAlignStyle + + // TableCellAlignNone does not care about alignments. + // If you using classes or other styles, you can add these attributes + // in an ASTTransformer. + TableCellAlignNone +) + +// TableConfig struct holds options for the extension. +type TableConfig struct { + html.Config + + // TableCellAlignMethod indicates how are table celss aligned. + TableCellAlignMethod TableCellAlignMethod +} + +// TableOption interface is a functional option interface for the extension. +type TableOption interface { + renderer.Option + // SetTableOption sets given option to the extension. + SetTableOption(*TableConfig) +} + +// NewTableConfig returns a new Config with defaults. +func NewTableConfig() TableConfig { + return TableConfig{ + Config: html.NewConfig(), + TableCellAlignMethod: TableCellAlignDefault, + } +} + +// SetOption implements renderer.SetOptioner. +func (c *TableConfig) SetOption(name renderer.OptionName, value any) { + switch name { + case optTableCellAlignMethod: + c.TableCellAlignMethod = value.(TableCellAlignMethod) + default: + c.Config.SetOption(name, value) + } +} + +type withTableHTMLOptions struct { + value []html.Option +} + +func (o *withTableHTMLOptions) SetConfig(c *renderer.Config) { + if o.value != nil { + for _, v := range o.value { + v.(renderer.Option).SetConfig(c) + } + } +} + +func (o *withTableHTMLOptions) SetTableOption(c *TableConfig) { + if o.value != nil { + for _, v := range o.value { + v.SetHTMLOption(&c.Config) + } + } +} + +// WithTableHTMLOptions is functional option that wraps goldmark HTMLRenderer options. +func WithTableHTMLOptions(opts ...html.Option) TableOption { + return &withTableHTMLOptions{opts} +} + +const optTableCellAlignMethod renderer.OptionName = "TableTableCellAlignMethod" + +type withTableCellAlignMethod struct { + value TableCellAlignMethod +} + +func (o *withTableCellAlignMethod) SetConfig(c *renderer.Config) { + c.Options[optTableCellAlignMethod] = o.value +} + +func (o *withTableCellAlignMethod) SetTableOption(c *TableConfig) { + c.TableCellAlignMethod = o.value +} + +// WithTableCellAlignMethod is a functional option that indicates how are table cells aligned in HTML format. +func WithTableCellAlignMethod(a TableCellAlignMethod) TableOption { + return &withTableCellAlignMethod{a} +} + +func isTableDelim(bs []byte) bool { + if w, _ := util.IndentWidth(bs, 0); w > 3 { + return false + } + allSep := true + for _, b := range bs { + if b != '-' { + allSep = false + } + if !(util.IsSpace(b) || b == '-' || b == '|' || b == ':') { + return false + } + } + return !allSep +} + +var tableDelimLeft = regexp.MustCompile(`^\s*\:\-+\s*$`) +var tableDelimRight = regexp.MustCompile(`^\s*\-+\:\s*$`) +var tableDelimCenter = regexp.MustCompile(`^\s*\:\-+\:\s*$`) +var tableDelimNone = regexp.MustCompile(`^\s*\-+\s*$`) + +type tableParagraphTransformer struct { +} + +var defaultTableParagraphTransformer = &tableParagraphTransformer{} + +// NewTableParagraphTransformer returns a new ParagraphTransformer +// that can transform paragraphs into tables. +func NewTableParagraphTransformer() parser.ParagraphTransformer { + return defaultTableParagraphTransformer +} + +func (b *tableParagraphTransformer) Transform(node *gast.Paragraph, reader text.Reader, pc parser.Context) { + ppos := node.Pos() + lines := node.Lines() + if lines.Len() < 2 { + return + } + for i := 1; i < lines.Len(); i++ { + alignments := b.parseDelimiter(lines.At(i), reader) + if alignments == nil { + continue + } + header := b.parseRow(lines.At(i-1), alignments, true, reader, pc) + if header == nil || len(alignments) != header.ChildCount() { + return + } + table := ast.NewTable() + table.Alignments = alignments + table.SetPos(ppos) + table.AppendChild(table, ast.NewTableHeader(header)) + for j := i + 1; j < lines.Len(); j++ { + table.AppendChild(table, b.parseRow(lines.At(j), alignments, false, reader, pc)) + } + node.Lines().SetSliced(0, i-1) + node.Parent().InsertAfter(node.Parent(), node, table) + if node.Lines().Len() == 0 { + node.Parent().RemoveChild(node.Parent(), node) + } else { + last := node.Lines().At(i - 2) + last.Stop = last.Stop - 1 // trim last newline(\n) + node.Lines().Set(i-2, last) + } + } +} + +func (b *tableParagraphTransformer) parseRow(segment text.Segment, + alignments []ast.Alignment, isHeader bool, reader text.Reader, pc parser.Context) *ast.TableRow { + npos := segment + source := reader.Source() + segment = segment.TrimLeftSpace(source) + segment = segment.TrimRightSpace(source) + line := segment.Value(source) + pos := 0 + limit := len(line) + row := ast.NewTableRow(alignments) + row.SetPos(npos.Start) + if len(line) > 0 && line[pos] == '|' { + pos++ + } + if len(line) > 0 && line[limit-1] == '|' { + limit-- + } + i := 0 + for ; pos < limit; i++ { + alignment := ast.AlignNone + if i >= len(alignments) { + if !isHeader { + return row + } + } else { + alignment = alignments[i] + } + + var escapedCell *escapedPipeCell + node := ast.NewTableCell() + node.SetPos(npos.Start + pos - npos.Padding) + node.Alignment = alignment + hasBacktick := false + closure := pos + for ; closure < limit; closure++ { + if line[closure] == '`' { + hasBacktick = true + } + if line[closure] == '|' { + if closure == 0 || line[closure-1] != '\\' { + break + } else if hasBacktick { + if escapedCell == nil { + escapedCell = &escapedPipeCell{node, []int{}, false} + escapedList := pc.ComputeIfAbsent(escapedPipeCellListKey, + func() any { + return []*escapedPipeCell{} + }).([]*escapedPipeCell) + escapedList = append(escapedList, escapedCell) + pc.Set(escapedPipeCellListKey, escapedList) + } + escapedCell.Pos = append(escapedCell.Pos, segment.Start+closure-1) + } + } + } + seg := text.NewSegment(segment.Start+pos, segment.Start+closure) + seg = seg.TrimLeftSpace(source) + seg = seg.TrimRightSpace(source) + node.Lines().Append(seg) + row.AppendChild(row, node) + pos = closure + 1 + } + for ; i < len(alignments); i++ { + row.AppendChild(row, ast.NewTableCell()) + } + return row +} + +func (b *tableParagraphTransformer) parseDelimiter(segment text.Segment, reader text.Reader) []ast.Alignment { + + line := segment.Value(reader.Source()) + if !isTableDelim(line) { + return nil + } + cols := bytes.Split(line, []byte{'|'}) + if util.IsBlank(cols[0]) { + cols = cols[1:] + } + if len(cols) > 0 && util.IsBlank(cols[len(cols)-1]) { + cols = cols[:len(cols)-1] + } + + var alignments []ast.Alignment + for _, col := range cols { + if tableDelimLeft.Match(col) { + alignments = append(alignments, ast.AlignLeft) + } else if tableDelimRight.Match(col) { + alignments = append(alignments, ast.AlignRight) + } else if tableDelimCenter.Match(col) { + alignments = append(alignments, ast.AlignCenter) + } else if tableDelimNone.Match(col) { + alignments = append(alignments, ast.AlignNone) + } else { + return nil + } + } + return alignments +} + +type tableASTTransformer struct { +} + +var defaultTableASTTransformer = &tableASTTransformer{} + +// NewTableASTTransformer returns a parser.ASTTransformer for tables. +func NewTableASTTransformer() parser.ASTTransformer { + return defaultTableASTTransformer +} + +func (a *tableASTTransformer) Transform(node *gast.Document, reader text.Reader, pc parser.Context) { + lst := pc.Get(escapedPipeCellListKey) + if lst == nil { + return + } + pc.Set(escapedPipeCellListKey, nil) + for _, v := range lst.([]*escapedPipeCell) { + if v.Transformed { + continue + } + _ = gast.Walk(v.Cell, func(n gast.Node, entering bool) (gast.WalkStatus, error) { + if !entering || n.Kind() != gast.KindCodeSpan { + return gast.WalkContinue, nil + } + + for c := n.FirstChild(); c != nil; { + next := c.NextSibling() + if c.Kind() != gast.KindText { + c = next + continue + } + parent := c.Parent() + ts := &c.(*gast.Text).Segment + n := c + for _, v := range lst.([]*escapedPipeCell) { + for _, pos := range v.Pos { + if ts.Start <= pos && pos < ts.Stop { + segment := n.(*gast.Text).Segment + n1 := gast.NewRawTextSegment(segment.WithStop(pos)) + n2 := gast.NewRawTextSegment(segment.WithStart(pos + 1)) + parent.InsertAfter(parent, n, n1) + parent.InsertAfter(parent, n1, n2) + parent.RemoveChild(parent, n) + n = n2 + v.Transformed = true + } + } + } + c = next + } + return gast.WalkContinue, nil + }) + } +} + +// TableHTMLRenderer is a renderer.NodeRenderer implementation that +// renders Table nodes. +type TableHTMLRenderer struct { + TableConfig +} + +// NewTableHTMLRenderer returns a new TableHTMLRenderer. +func NewTableHTMLRenderer(opts ...TableOption) renderer.NodeRenderer { + r := &TableHTMLRenderer{ + TableConfig: NewTableConfig(), + } + for _, opt := range opts { + opt.SetTableOption(&r.TableConfig) + } + return r +} + +// RegisterFuncs implements renderer.NodeRenderer.RegisterFuncs. +func (r *TableHTMLRenderer) RegisterFuncs(reg renderer.NodeRendererFuncRegisterer) { + reg.Register(ast.KindTable, r.renderTable) + reg.Register(ast.KindTableHeader, r.renderTableHeader) + reg.Register(ast.KindTableRow, r.renderTableRow) + reg.Register(ast.KindTableCell, r.renderTableCell) +} + +// TableAttributeFilter defines attribute names which table elements can have. +// +// - align: Deprecated +// - bgcolor: Deprecated +// - border: Deprecated +// - cellpadding: Deprecated +// - cellspacing: Deprecated +// - frame: Deprecated +// - rules: Deprecated +// - summary: Deprecated +// - width: Deprecated. +var TableAttributeFilter = html.GlobalAttributeFilter.ExtendString(`align,bgcolor,border,cellpadding,cellspacing,frame,rules,summary,width`) // nolint: lll + +func (r *TableHTMLRenderer) renderTable( + w util.BufWriter, source []byte, n gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + _, _ = w.WriteString("\n") + } else { + _, _ = w.WriteString("\n") + } + return gast.WalkContinue, nil +} + +// TableHeaderAttributeFilter defines attribute names which elements can have. +// +// - align: Deprecated since HTML4, Obsolete since HTML5 +// - bgcolor: Not Standardized +// - char: Deprecated since HTML4, Obsolete since HTML5 +// - charoff: Deprecated since HTML4, Obsolete since HTML5 +// - valign: Deprecated since HTML4, Obsolete since HTML5. +var TableHeaderAttributeFilter = html.GlobalAttributeFilter.ExtendString(`align,bgcolor,char,charoff,valign`) + +func (r *TableHTMLRenderer) renderTableHeader( + w util.BufWriter, source []byte, n gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + _, _ = w.WriteString("\n") + _, _ = w.WriteString("\n") // Header has no separate handle + } else { + _, _ = w.WriteString("\n") + _, _ = w.WriteString("\n") + if n.NextSibling() != nil { + _, _ = w.WriteString("\n") + } + } + return gast.WalkContinue, nil +} + +// TableRowAttributeFilter defines attribute names which elements can have. +// +// - align: Obsolete since HTML5 +// - bgcolor: Obsolete since HTML5 +// - char: Obsolete since HTML5 +// - charoff: Obsolete since HTML5 +// - valign: Obsolete since HTML5. +var TableRowAttributeFilter = html.GlobalAttributeFilter.ExtendString(`align,bgcolor,char,charoff,valign`) + +func (r *TableHTMLRenderer) renderTableRow( + w util.BufWriter, source []byte, n gast.Node, entering bool) (gast.WalkStatus, error) { + if entering { + _, _ = w.WriteString("\n") + } else { + _, _ = w.WriteString("\n") + if n.Parent().LastChild() == n { + _, _ = w.WriteString("\n") + } + } + return gast.WalkContinue, nil +} + +// TableThCellAttributeFilter defines attribute names which table cells can have. +// +// - abbr: [OK] Contains a short abbreviated description of the cell's content [NOT OK in ] +// - align: Obsolete since HTML5 +// - axis: Obsolete since HTML5 +// - bgcolor: Not Standardized +// - char: Obsolete since HTML5 +// - charoff: Obsolete since HTML5 +// - colspan: [OK] Number of columns that the cell is to span +// - headers: [OK] This attribute contains a list of space-separated strings, +// each corresponding to the id attribute of the elements that apply to this element +// - height: Deprecated since HTML4. Obsolete since HTML5 +// - rowspan: [OK] Number of rows that the cell is to span +// - scope: [OK] This enumerated attribute defines the cells that the header +// (defined in the ) element relates to [NOT OK in ] +// - valign: Obsolete since HTML5 +// - width: Deprecated since HTML4. Obsolete since HTML5. +var TableThCellAttributeFilter = html.GlobalAttributeFilter.ExtendString(`abbr,align,axis,bgcolor,char,charoff,colspan,headers,height,rowspan,scope,valign,width`) // nolint:lll + +// TableTdCellAttributeFilter defines attribute names which table cells can have. +// +// - abbr: Obsolete since HTML5. [OK in ] +// - align: Obsolete since HTML5 +// - axis: Obsolete since HTML5 +// - bgcolor: Not Standardized +// - char: Obsolete since HTML5 +// - charoff: Obsolete since HTML5 +// - colspan: [OK] Number of columns that the cell is to span +// - headers: [OK] This attribute contains a list of space-separated strings, each corresponding +// to the id attribute of the elements that apply to this element +// - height: Deprecated since HTML4. Obsolete since HTML5 +// - rowspan: [OK] Number of rows that the cell is to span +// - scope: Obsolete since HTML5. [OK in ] +// - valign: Obsolete since HTML5 +// - width: Deprecated since HTML4. Obsolete since HTML5. +var TableTdCellAttributeFilter = html.GlobalAttributeFilter.ExtendString(`abbr,align,axis,bgcolor,char,charoff,colspan,headers,height,rowspan,scope,valign,width`) // nolint: lll + +func (r *TableHTMLRenderer) renderTableCell( + w util.BufWriter, source []byte, node gast.Node, entering bool) (gast.WalkStatus, error) { + n := node.(*ast.TableCell) + tag := "td" + if n.Parent().Kind() == ast.KindTableHeader { + tag = "th" + } + if entering { + _, _ = fmt.Fprintf(w, "<%s", tag) + if n.Alignment != ast.AlignNone { + amethod := r.TableConfig.TableCellAlignMethod + if amethod == TableCellAlignDefault { + if r.Config.XHTML { + amethod = TableCellAlignAttribute + } else { + amethod = TableCellAlignStyle + } + } + switch amethod { + case TableCellAlignAttribute: + if _, ok := n.AttributeString("align"); !ok { // Skip align render if overridden + _, _ = fmt.Fprintf(w, ` align="%s"`, n.Alignment.String()) + } + case TableCellAlignStyle: + v, ok := n.AttributeString("style") + var cob util.CopyOnWriteBuffer + if ok { + switch v := v.(type) { + case []byte: + cob = util.NewCopyOnWriteBuffer(v) + case string: + cob = util.NewCopyOnWriteBuffer([]byte(v)) + } + cob.AppendByte(';') + } + style := fmt.Sprintf("text-align:%s", n.Alignment.String()) + cob.AppendString(style) + n.SetAttributeString("style", cob.Bytes()) + } + } + if n.Attributes() != nil { + if tag == "td" { + html.RenderAttributes(w, n, TableTdCellAttributeFilter) // + } else { + html.RenderAttributes(w, n, TableThCellAttributeFilter) // + } + } + _ = w.WriteByte('>') + } else { + _, _ = fmt.Fprintf(w, "\n", tag) + } + return gast.WalkContinue, nil +} + +type table struct { + options []TableOption +} + +// Table is an extension that allow you to use GFM tables . +var Table = &table{ + options: []TableOption{}, +} + +// NewTable returns a new extension with given options. +func NewTable(opts ...TableOption) goldmark.Extender { + return &table{ + options: opts, + } +} + +func (e *table) Extend(m goldmark.Markdown) { + m.Parser().AddOptions( + parser.WithParagraphTransformers( + util.Prioritized(NewTableParagraphTransformer(), 200), + ), + parser.WithASTTransformers( + util.Prioritized(defaultTableASTTransformer, 0), + ), + ) + m.Renderer().AddOptions(renderer.WithNodeRenderers( + util.Prioritized(NewTableHTMLRenderer(e.options...), 500), + )) +} diff --git a/extension/table_test.go b/extension/table_test.go new file mode 100644 index 0000000..21a4663 --- /dev/null +++ b/extension/table_test.go @@ -0,0 +1,394 @@ +package extension + +import ( + "testing" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/ast" + east "github.com/yuin/goldmark/extension/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +func TestTable(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + html.WithXHTML(), + ), + goldmark.WithExtensions( + Table, + ), + ) + testutil.DoTestCaseFile(markdown, "_test/table.txt", t, testutil.ParseCliCaseArg()...) +} + +func TestTableWithAlignDefault(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable( + WithTableCellAlignMethod(TableCellAlignDefault), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Description: "Cell with TableCellAlignDefault and XHTML should be rendered as an align attribute", + Markdown: ` +| abc | defghi | +:-: | -----------: +bar | baz +`, + Expected: ` + + + + + + + + + + + + +
    abcdefghi
    barbaz
    `, + }, + t, + ) + + markdown = goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable( + WithTableCellAlignMethod(TableCellAlignDefault), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 2, + Description: "Cell with TableCellAlignDefault and HTML5 should be rendered as a style attribute", + Markdown: ` +| abc | defghi | +:-: | -----------: +bar | baz +`, + Expected: ` + + + + + + + + + + + + +
    abcdefghi
    barbaz
    `, + }, + t, + ) +} + +func TestTableWithAlignAttribute(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable( + WithTableCellAlignMethod(TableCellAlignAttribute), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Description: "Cell with TableCellAlignAttribute and XHTML should be rendered as an align attribute", + Markdown: ` +| abc | defghi | +:-: | -----------: +bar | baz +`, + Expected: ` + + + + + + + + + + + + +
    abcdefghi
    barbaz
    `, + }, + t, + ) + + markdown = goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable( + WithTableCellAlignMethod(TableCellAlignAttribute), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 2, + Description: "Cell with TableCellAlignAttribute and HTML5 should be rendered as an align attribute", + Markdown: ` +| abc | defghi | +:-: | -----------: +bar | baz +`, + Expected: ` + + + + + + + + + + + + +
    abcdefghi
    barbaz
    `, + }, + t, + ) +} + +type tableStyleTransformer struct { +} + +func (a *tableStyleTransformer) Transform(node *ast.Document, reader text.Reader, pc parser.Context) { + cell := node.FirstChild().FirstChild().FirstChild().(*east.TableCell) + cell.SetAttributeString("style", []byte("font-size:1em")) +} + +func TestTableWithAlignStyle(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable( + WithTableCellAlignMethod(TableCellAlignStyle), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Description: "Cell with TableCellAlignStyle and XHTML should be rendered as a style attribute", + Markdown: ` +| abc | defghi | +:-: | -----------: +bar | baz +`, + Expected: ` + + + + + + + + + + + + +
    abcdefghi
    barbaz
    `, + }, + t, + ) + + markdown = goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable( + WithTableCellAlignMethod(TableCellAlignStyle), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 2, + Description: "Cell with TableCellAlignStyle and HTML5 should be rendered as a style attribute", + Markdown: ` +| abc | defghi | +:-: | -----------: +bar | baz +`, + Expected: ` + + + + + + + + + + + + +
    abcdefghi
    barbaz
    `, + }, + t, + ) + + markdown = goldmark.New( + goldmark.WithParserOptions( + parser.WithASTTransformers( + util.Prioritized(&tableStyleTransformer{}, 0), + ), + ), + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable( + WithTableCellAlignMethod(TableCellAlignStyle), + ), + ), + ) + + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 3, + Description: "Styled cell should not be broken the style by the alignments", + Markdown: ` +| abc | defghi | +:-: | -----------: +bar | baz +`, + Expected: ` + + + + + + + + + + + + +
    abcdefghi
    barbaz
    `, + }, + t, + ) +} + +func TestTableWithAlignNone(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable( + WithTableCellAlignMethod(TableCellAlignNone), + ), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Description: "Cell with TableCellAlignStyle and XHTML should not be rendered", + Markdown: ` +| abc | defghi | +:-: | -----------: +bar | baz +`, + Expected: ` + + + + + + + + + + + + +
    abcdefghi
    barbaz
    `, + }, + t, + ) +} + +func TestTableFuzzedPanics(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + ), + goldmark.WithExtensions( + NewTable(), + ), + ) + testutil.DoTestCase( + markdown, + testutil.MarkdownTestCase{ + No: 1, + Description: "This should not panic", + Markdown: "* 0\n-|\n\t0", + Expected: `
      +
    • + + + + + + + + + + + +
      0
      0
      +
    • +
    `, + }, + t, + ) +} diff --git a/extension/tasklist.go b/extension/tasklist.go new file mode 100644 index 0000000..4467ebf --- /dev/null +++ b/extension/tasklist.go @@ -0,0 +1,120 @@ +package extension + +import ( + "regexp" + + "github.com/yuin/goldmark" + gast "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/extension/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +var taskListRegexp = regexp.MustCompile(`^\[([\sxX])\]\s*`) + +type taskCheckBoxParser struct { +} + +var defaultTaskCheckBoxParser = &taskCheckBoxParser{} + +// NewTaskCheckBoxParser returns a new InlineParser that can parse +// checkboxes in list items. +// This parser must take precedence over the parser.LinkParser. +func NewTaskCheckBoxParser() parser.InlineParser { + return defaultTaskCheckBoxParser +} + +func (s *taskCheckBoxParser) Trigger() []byte { + return []byte{'['} +} + +func (s *taskCheckBoxParser) Parse(parent gast.Node, block text.Reader, pc parser.Context) gast.Node { + // Given AST structure must be like + // - List + // - ListItem : parent.Parent + // - TextBlock : parent + // (current line) + if parent.Parent() == nil || parent.Parent().FirstChild() != parent { + return nil + } + + if parent.HasChildren() { + return nil + } + if _, ok := parent.Parent().(*gast.ListItem); !ok { + return nil + } + line, _ := block.PeekLine() + m := taskListRegexp.FindSubmatchIndex(line) + if m == nil { + return nil + } + value := line[m[2]:m[3]][0] + block.Advance(m[1]) + checked := value == 'x' || value == 'X' + return ast.NewTaskCheckBox(checked) +} + +func (s *taskCheckBoxParser) CloseBlock(parent gast.Node, pc parser.Context) { + // nothing to do +} + +// TaskCheckBoxHTMLRenderer is a renderer.NodeRenderer implementation that +// renders checkboxes in list items. +type TaskCheckBoxHTMLRenderer struct { + html.Config +} + +// NewTaskCheckBoxHTMLRenderer returns a new TaskCheckBoxHTMLRenderer. +func NewTaskCheckBoxHTMLRenderer(opts ...html.Option) renderer.NodeRenderer { + r := &TaskCheckBoxHTMLRenderer{ + Config: html.NewConfig(), + } + for _, opt := range opts { + opt.SetHTMLOption(&r.Config) + } + return r +} + +// RegisterFuncs implements renderer.NodeRenderer.RegisterFuncs. +func (r *TaskCheckBoxHTMLRenderer) RegisterFuncs(reg renderer.NodeRendererFuncRegisterer) { + reg.Register(ast.KindTaskCheckBox, r.renderTaskCheckBox) +} + +func (r *TaskCheckBoxHTMLRenderer) renderTaskCheckBox( + w util.BufWriter, source []byte, node gast.Node, entering bool) (gast.WalkStatus, error) { + if !entering { + return gast.WalkContinue, nil + } + n := node.(*ast.TaskCheckBox) + + if n.IsChecked { + _, _ = w.WriteString(` ") + } else { + _, _ = w.WriteString("> ") + } + return gast.WalkContinue, nil +} + +type taskList struct { +} + +// TaskList is an extension that allow you to use GFM task lists. +var TaskList = &taskList{} + +func (e *taskList) Extend(m goldmark.Markdown) { + m.Parser().AddOptions(parser.WithInlineParsers( + util.Prioritized(NewTaskCheckBoxParser(), 0), + )) + m.Renderer().AddOptions(renderer.WithNodeRenderers( + util.Prioritized(NewTaskCheckBoxHTMLRenderer(), 500), + )) +} diff --git a/extension/tasklist_test.go b/extension/tasklist_test.go new file mode 100644 index 0000000..e376227 --- /dev/null +++ b/extension/tasklist_test.go @@ -0,0 +1,21 @@ +package extension + +import ( + "testing" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" +) + +func TestTaskList(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + TaskList, + ), + ) + testutil.DoTestCaseFile(markdown, "_test/tasklist.txt", t, testutil.ParseCliCaseArg()...) +} diff --git a/extension/typographer.go b/extension/typographer.go new file mode 100644 index 0000000..3a3f106 --- /dev/null +++ b/extension/typographer.go @@ -0,0 +1,348 @@ +package extension + +import ( + "unicode" + + "github.com/yuin/goldmark" + gast "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +var uncloseCounterKey = parser.NewContextKey() + +type unclosedCounter struct { + Single int + Double int +} + +func (u *unclosedCounter) Reset() { + u.Single = 0 + u.Double = 0 +} + +func getUnclosedCounter(pc parser.Context) *unclosedCounter { + v := pc.Get(uncloseCounterKey) + if v == nil { + v = &unclosedCounter{} + pc.Set(uncloseCounterKey, v) + } + return v.(*unclosedCounter) +} + +// TypographicPunctuation is a key of the punctuations that can be replaced with +// typographic entities. +type TypographicPunctuation int + +const ( + // LeftSingleQuote is ' . + LeftSingleQuote TypographicPunctuation = iota + 1 + // RightSingleQuote is ' . + RightSingleQuote + // LeftDoubleQuote is " . + LeftDoubleQuote + // RightDoubleQuote is " . + RightDoubleQuote + // EnDash is -- . + EnDash + // EmDash is --- . + EmDash + // Ellipsis is ... . + Ellipsis + // LeftAngleQuote is << . + LeftAngleQuote + // RightAngleQuote is >> . + RightAngleQuote + // Apostrophe is ' . + Apostrophe + + typographicPunctuationMax +) + +// An TypographerConfig struct is a data structure that holds configuration of the +// Typographer extension. +type TypographerConfig struct { + Substitutions [][]byte +} + +func newDefaultSubstitutions() [][]byte { + replacements := make([][]byte, typographicPunctuationMax) + replacements[LeftSingleQuote] = []byte("‘") + replacements[RightSingleQuote] = []byte("’") + replacements[LeftDoubleQuote] = []byte("“") + replacements[RightDoubleQuote] = []byte("”") + replacements[EnDash] = []byte("–") + replacements[EmDash] = []byte("—") + replacements[Ellipsis] = []byte("…") + replacements[LeftAngleQuote] = []byte("«") + replacements[RightAngleQuote] = []byte("»") + replacements[Apostrophe] = []byte("’") + + return replacements +} + +// SetOption implements SetOptioner. +func (b *TypographerConfig) SetOption(name parser.OptionName, value any) { + switch name { + case optTypographicSubstitutions: + b.Substitutions = value.([][]byte) + } +} + +// A TypographerOption interface sets options for the TypographerParser. +type TypographerOption interface { + parser.Option + SetTypographerOption(*TypographerConfig) +} + +const optTypographicSubstitutions parser.OptionName = "TypographicSubstitutions" + +// TypographicSubstitutions is a list of the substitutions for the Typographer extension. +type TypographicSubstitutions map[TypographicPunctuation][]byte + +type withTypographicSubstitutions struct { + value [][]byte +} + +func (o *withTypographicSubstitutions) SetParserOption(c *parser.Config) { + c.Options[optTypographicSubstitutions] = o.value +} + +func (o *withTypographicSubstitutions) SetTypographerOption(p *TypographerConfig) { + p.Substitutions = o.value +} + +// WithTypographicSubstitutions is a functional otpion that specify replacement text +// for punctuations. +func WithTypographicSubstitutions[T []byte | string](values map[TypographicPunctuation]T) TypographerOption { + replacements := newDefaultSubstitutions() + for k, v := range values { + replacements[k] = []byte(v) + } + + return &withTypographicSubstitutions{replacements} +} + +type typographerDelimiterProcessor struct { +} + +func (p *typographerDelimiterProcessor) IsDelimiter(b byte) bool { + return b == '\'' || b == '"' +} + +func (p *typographerDelimiterProcessor) CanOpenCloser(opener, closer *parser.Delimiter) bool { + return opener.Char == closer.Char +} + +func (p *typographerDelimiterProcessor) OnMatch(consumes int) gast.Node { + return nil +} + +var defaultTypographerDelimiterProcessor = &typographerDelimiterProcessor{} + +type typographerParser struct { + TypographerConfig +} + +// NewTypographerParser return a new InlineParser that parses +// typographer expressions. +func NewTypographerParser(opts ...TypographerOption) parser.InlineParser { + p := &typographerParser{ + TypographerConfig: TypographerConfig{ + Substitutions: newDefaultSubstitutions(), + }, + } + for _, o := range opts { + o.SetTypographerOption(&p.TypographerConfig) + } + return p +} + +func (s *typographerParser) Trigger() []byte { + return []byte{'\'', '"', '-', '.', ',', '<', '>', '*', '['} +} + +func (s *typographerParser) Parse(parent gast.Node, block text.Reader, pc parser.Context) gast.Node { + line, _ := block.PeekLine() + c := line[0] + if len(line) > 2 { + if c == '-' { + if s.Substitutions[EmDash] != nil && line[1] == '-' && line[2] == '-' { // --- + node := gast.NewString(s.Substitutions[EmDash]) + node.SetCode(true) + block.Advance(3) + return node + } + } else if c == '.' { + if s.Substitutions[Ellipsis] != nil && line[1] == '.' && line[2] == '.' { // ... + node := gast.NewString(s.Substitutions[Ellipsis]) + node.SetCode(true) + block.Advance(3) + return node + } + return nil + } + } + if len(line) > 1 { + if c == '<' { + if s.Substitutions[LeftAngleQuote] != nil && line[1] == '<' { // << + node := gast.NewString(s.Substitutions[LeftAngleQuote]) + node.SetCode(true) + block.Advance(2) + return node + } + return nil + } else if c == '>' { + if s.Substitutions[RightAngleQuote] != nil && line[1] == '>' { // >> + node := gast.NewString(s.Substitutions[RightAngleQuote]) + node.SetCode(true) + block.Advance(2) + return node + } + return nil + } else if s.Substitutions[EnDash] != nil && c == '-' && line[1] == '-' { // -- + node := gast.NewString(s.Substitutions[EnDash]) + node.SetCode(true) + block.Advance(2) + return node + } + } + if c == '\'' || c == '"' { + before := block.PrecendingCharacter() + d := parser.ScanDelimiter(line, before, 1, defaultTypographerDelimiterProcessor) + if d == nil { + return nil + } + counter := getUnclosedCounter(pc) + if c == '\'' { + if s.Substitutions[Apostrophe] != nil { + // Handle decade abbrevations such as '90s + if d.CanOpen && !d.CanClose && len(line) > 3 && + util.IsNumeric(line[1]) && util.IsNumeric(line[2]) && line[3] == 's' { + after := rune(' ') + if len(line) > 4 { + after = util.ToRune(line, 4) + } + if len(line) == 3 || util.IsSpaceRune(after) || util.IsPunctRune(after) { + node := gast.NewString(s.Substitutions[Apostrophe]) + node.SetCode(true) + block.Advance(1) + return node + } + } + // special cases: 'twas, 'em, 'net + if len(line) > 1 && (unicode.IsPunct(before) || unicode.IsSpace(before)) && + (line[1] == 't' || line[1] == 'e' || line[1] == 'n' || line[1] == 'l') { + node := gast.NewString(s.Substitutions[Apostrophe]) + node.SetCode(true) + block.Advance(1) + return node + } + // Convert normal apostrophes. This is probably more flexible than necessary but + // converts any apostrophe in between two alphanumerics. + if len(line) > 1 && (unicode.IsDigit(before) || unicode.IsLetter(before)) && + (unicode.IsLetter(util.ToRune(line, 1))) { + node := gast.NewString(s.Substitutions[Apostrophe]) + node.SetCode(true) + block.Advance(1) + return node + } + } + if s.Substitutions[LeftSingleQuote] != nil && d.CanOpen && !d.CanClose { + nt := LeftSingleQuote + // special cases: Alice's, I'm, Don't, You'd + if len(line) > 1 && (line[1] == 's' || line[1] == 'm' || line[1] == 't' || line[1] == 'd') && + (len(line) < 3 || util.IsPunct(line[2]) || util.IsSpace(line[2])) { + nt = RightSingleQuote + } + // special cases: I've, I'll, You're + if len(line) > 2 && ((line[1] == 'v' && line[2] == 'e') || + (line[1] == 'l' && line[2] == 'l') || (line[1] == 'r' && line[2] == 'e')) && + (len(line) < 4 || util.IsPunct(line[3]) || util.IsSpace(line[3])) { + nt = RightSingleQuote + } + if nt == LeftSingleQuote { + counter.Single++ + } + + node := gast.NewString(s.Substitutions[nt]) + node.SetCode(true) + block.Advance(1) + return node + } + if s.Substitutions[RightSingleQuote] != nil { + // plural possesive and abbreviations: Smiths', doin' + if len(line) > 1 && unicode.IsSpace(util.ToRune(line, 0)) || unicode.IsPunct(util.ToRune(line, 0)) && + (len(line) > 2 && !unicode.IsDigit(util.ToRune(line, 1))) { + node := gast.NewString(s.Substitutions[RightSingleQuote]) + node.SetCode(true) + block.Advance(1) + return node + } + } + if s.Substitutions[RightSingleQuote] != nil && counter.Single > 0 { + isClose := d.CanClose && !d.CanOpen + maybeClose := d.CanClose && d.CanOpen && len(line) > 1 && unicode.IsPunct(util.ToRune(line, 1)) && + (len(line) == 2 || (len(line) > 2 && util.IsPunct(line[2]) || util.IsSpace(line[2]))) + if isClose || maybeClose { + node := gast.NewString(s.Substitutions[RightSingleQuote]) + node.SetCode(true) + block.Advance(1) + counter.Single-- + return node + } + } + } + if c == '"' { + if s.Substitutions[LeftDoubleQuote] != nil && d.CanOpen && !d.CanClose { + node := gast.NewString(s.Substitutions[LeftDoubleQuote]) + node.SetCode(true) + block.Advance(1) + counter.Double++ + return node + } + if s.Substitutions[RightDoubleQuote] != nil && counter.Double > 0 { + isClose := d.CanClose && !d.CanOpen + maybeClose := d.CanClose && d.CanOpen && len(line) > 1 && (unicode.IsPunct(util.ToRune(line, 1))) && + (len(line) == 2 || (len(line) > 2 && util.IsPunct(line[2]) || util.IsSpace(line[2]))) + if isClose || maybeClose { + // special case: "Monitor 21"" + if len(line) > 1 && line[1] == '"' && unicode.IsDigit(before) { + return nil + } + node := gast.NewString(s.Substitutions[RightDoubleQuote]) + node.SetCode(true) + block.Advance(1) + counter.Double-- + return node + } + } + } + } + return nil +} + +func (s *typographerParser) CloseBlock(parent gast.Node, pc parser.Context) { + getUnclosedCounter(pc).Reset() +} + +type typographer struct { + options []TypographerOption +} + +// Typographer is an extension that replaces punctuations with typographic entities. +var Typographer = &typographer{} + +// NewTypographer returns a new Extender that replaces punctuations with typographic entities. +func NewTypographer(opts ...TypographerOption) goldmark.Extender { + return &typographer{ + options: opts, + } +} + +func (e *typographer) Extend(m goldmark.Markdown) { + m.Parser().AddOptions(parser.WithInlineParsers( + util.Prioritized(NewTypographerParser(e.options...), 9999), + )) +} diff --git a/extension/typographer_test.go b/extension/typographer_test.go new file mode 100644 index 0000000..f8eded1 --- /dev/null +++ b/extension/typographer_test.go @@ -0,0 +1,21 @@ +package extension + +import ( + "testing" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" +) + +func TestTypographer(t *testing.T) { + markdown := goldmark.New( + goldmark.WithRendererOptions( + html.WithUnsafe(), + ), + goldmark.WithExtensions( + Typographer, + ), + ) + testutil.DoTestCaseFile(markdown, "_test/typographer.txt", t, testutil.ParseCliCaseArg()...) +} diff --git a/extra_test.go b/extra_test.go new file mode 100644 index 0000000..b6fba43 --- /dev/null +++ b/extra_test.go @@ -0,0 +1,281 @@ +package goldmark_test + +import ( + "bytes" + "os" + "strconv" + "strings" + "testing" + "time" + + . "github.com/yuin/goldmark" + "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/renderer/html" + "github.com/yuin/goldmark/testutil" + "github.com/yuin/goldmark/text" +) + +var testTimeoutMultiplier = 1.0 + +func init() { + m, err := strconv.ParseFloat(os.Getenv("GOLDMARK_TEST_TIMEOUT_MULTIPLIER"), 64) + if err == nil { + testTimeoutMultiplier = m + } +} + +func TestExtras(t *testing.T) { + markdown := New(WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + testutil.DoTestCaseFile(markdown, "_test/extra.txt", t, testutil.ParseCliCaseArg()...) +} + +func TestEndsWithNonSpaceCharacters(t *testing.T) { + markdown := New(WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + source := []byte("```\na\n```") + var b bytes.Buffer + err := markdown.Convert(source, &b) + if err != nil { + t.Error(err.Error()) + } + if b.String() != "
    a\n
    \n" { + t.Errorf("%s \n---------\n %s", source, b.String()) + } +} + +func TestWindowsNewLine(t *testing.T) { + markdown := New(WithRendererOptions( + html.WithXHTML(), + )) + source := []byte("a \r\nb\n") + var b bytes.Buffer + err := markdown.Convert(source, &b) + if err != nil { + t.Error(err.Error()) + } + if b.String() != "

    a
    \nb

    \n" { + t.Errorf("%s\n---------\n%s", source, b.String()) + } + + source = []byte("a\\\r\nb\r\n") + var b2 bytes.Buffer + err = markdown.Convert(source, &b2) + if err != nil { + t.Error(err.Error()) + } + if b2.String() != "

    a
    \nb

    \n" { + t.Errorf("\n%s\n---------\n%s", source, b2.String()) + } +} + +type myIDs struct { +} + +func (s *myIDs) Generate(value []byte, kind ast.NodeKind) []byte { + return []byte("my-id") +} + +func (s *myIDs) Put(value []byte) { +} + +func TestAutogeneratedIDs(t *testing.T) { + ctx := parser.NewContext(parser.WithIDs(&myIDs{})) + markdown := New(WithParserOptions(parser.WithAutoHeadingID())) + source := []byte("# Title1\n## Title2") + var b bytes.Buffer + err := markdown.Convert(source, &b, parser.WithContext(ctx)) + if err != nil { + t.Error(err.Error()) + } + if b.String() != `

    Title1

    +

    Title2

    +` { + t.Errorf("%s\n---------\n%s", source, b.String()) + } +} + +func nowMillis() int64 { + // TODO: replace UnixNano to UnixMillis(drops Go1.16 support) + return time.Now().UnixNano() / 1000000 +} + +func TestDeepNestedLabelPerformance(t *testing.T) { + if testing.Short() { + t.Skip("skipping performance test in short mode") + } + markdown := New(WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + + started := nowMillis() + n := 50000 + source := []byte(strings.Repeat("[", n) + strings.Repeat("]", n)) + var b bytes.Buffer + _ = markdown.Convert(source, &b) + finished := nowMillis() + if (finished - started) > int64(5000*testTimeoutMultiplier) { + t.Error("Parsing deep nested labels took too long") + } +} + +func TestManyProcessingInstructionPerformance(t *testing.T) { + if testing.Short() { + t.Skip("skipping performance test in short mode") + } + markdown := New(WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + + started := nowMillis() + n := 50000 + source := []byte("a " + strings.Repeat(" int64(5000*testTimeoutMultiplier) { + t.Error("Parsing processing instructions took too long") + } +} + +func TestManyCDATAPerformance(t *testing.T) { + if testing.Short() { + t.Skip("skipping performance test in short mode") + } + markdown := New(WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + + started := nowMillis() + n := 50000 + source := []byte(strings.Repeat("a int64(5000*testTimeoutMultiplier) { + t.Error("Parsing processing instructions took too long") + } +} + +func TestManyDeclPerformance(t *testing.T) { + if testing.Short() { + t.Skip("skipping performance test in short mode") + } + markdown := New(WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + + started := nowMillis() + n := 50000 + source := []byte(strings.Repeat("a int64(5000*testTimeoutMultiplier) { + t.Error("Parsing processing instructions took too long") + } +} + +func TestManyCommentPerformance(t *testing.T) { + if testing.Short() { + t.Skip("skipping performance test in short mode") + } + markdown := New(WithRendererOptions( + html.WithXHTML(), + html.WithUnsafe(), + )) + + started := nowMillis() + n := 50000 + source := []byte(strings.Repeat("a ") +var emptyComment2 = []byte("") +var openComment = []byte("") + +func (s *rawHTMLParser) parseComment(block text.Reader, _ Context) ast.Node { + savedLine, savedSegment := block.Position() + node := ast.NewRawHTML() + line, segment := block.PeekLine() + if bytes.HasPrefix(line, emptyComment1) { + node.Segments.Append(segment.WithStop(segment.Start + len(emptyComment1))) + block.Advance(len(emptyComment1)) + return node + } + if bytes.HasPrefix(line, emptyComment2) { + node.Segments.Append(segment.WithStop(segment.Start + len(emptyComment2))) + block.Advance(len(emptyComment2)) + return node + } + offset := len(openComment) + line = line[offset:] + for { + index := bytes.Index(line, closeComment) + if index > -1 { + node.Segments.Append(segment.WithStop(segment.Start + offset + index + len(closeComment))) + block.Advance(offset + index + len(closeComment)) + return node + } + offset = 0 + node.Segments.Append(segment) + block.AdvanceLine() + line, segment = block.PeekLine() + if line == nil { + break + } + } + block.SetPosition(savedLine, savedSegment) + return nil +} + +func (s *rawHTMLParser) parseUntil(block text.Reader, closer []byte, _ Context) ast.Node { + savedLine, savedSegment := block.Position() + node := ast.NewRawHTML() + for { + line, segment := block.PeekLine() + if line == nil { + break + } + index := bytes.Index(line, closer) + if index > -1 { + node.Segments.Append(segment.WithStop(segment.Start + index + len(closer))) + block.Advance(index + len(closer)) + return node + } + node.Segments.Append(segment) + block.AdvanceLine() + } + block.SetPosition(savedLine, savedSegment) + return nil +} + +func (s *rawHTMLParser) parseMultiLineRegexp(reg *regexp.Regexp, block text.Reader, _ Context) ast.Node { + sline, ssegment := block.Position() + if block.Match(reg) { + node := ast.NewRawHTML() + eline, esegment := block.Position() + block.SetPosition(sline, ssegment) + for { + line, segment := block.PeekLine() + if line == nil { + break + } + l, _ := block.Position() + start := segment.Start + if l == sline { + start = ssegment.Start + } + end := segment.Stop + if l == eline { + end = esegment.Start + } + + node.Segments.Append(text.NewSegment(start, end)) + if l == eline { + block.Advance(end - start) + break + } + block.AdvanceLine() + } + return node + } + return nil +} diff --git a/parser/setext_headings.go b/parser/setext_headings.go new file mode 100644 index 0000000..3558baa --- /dev/null +++ b/parser/setext_headings.go @@ -0,0 +1,127 @@ +package parser + +import ( + "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +var temporaryParagraphKey = NewContextKey() + +type setextHeadingParser struct { + HeadingConfig +} + +func matchesSetextHeadingBar(line []byte) (byte, bool) { + start := 0 + end := len(line) + space := util.TrimLeftLength(line, []byte{' '}) + if space > 3 { + return 0, false + } + start += space + level1 := util.TrimLeftLength(line[start:end], []byte{'='}) + c := byte('=') + var level2 int + if level1 == 0 { + level2 = util.TrimLeftLength(line[start:end], []byte{'-'}) + c = '-' + } + if util.IsSpace(line[end-1]) { + end -= util.TrimRightSpaceLength(line[start:end]) + } + if !((level1 > 0 && start+level1 == end) || (level2 > 0 && start+level2 == end)) { + return 0, false + } + return c, true +} + +// NewSetextHeadingParser return a new BlockParser that can parse Setext headings. +func NewSetextHeadingParser(opts ...HeadingOption) BlockParser { + p := &setextHeadingParser{} + for _, o := range opts { + o.SetHeadingOption(&p.HeadingConfig) + } + return p +} + +func (b *setextHeadingParser) Trigger() []byte { + return []byte{'-', '='} +} + +func (b *setextHeadingParser) Open(parent ast.Node, reader text.Reader, pc Context) (ast.Node, State) { + last := pc.LastOpenedBlock().Node + if last == nil { + return nil, NoChildren + } + paragraph, ok := last.(*ast.Paragraph) + if !ok || paragraph.Parent() != parent { + return nil, NoChildren + } + line, segment := reader.PeekLine() + c, ok := matchesSetextHeadingBar(line) + if !ok { + return nil, NoChildren + } + level := 1 + if c == '-' { + level = 2 + } + node := ast.NewHeading(level) + node.Lines().Append(segment) + pc.Set(temporaryParagraphKey, last) + return node, NoChildren | RequireParagraph +} + +func (b *setextHeadingParser) Continue(node ast.Node, reader text.Reader, pc Context) State { + return Close +} + +func (b *setextHeadingParser) Close(node ast.Node, reader text.Reader, pc Context) { + heading := node.(*ast.Heading) + segment := node.Lines().At(0) + heading.Lines().Clear() + tmp := pc.Get(temporaryParagraphKey).(*ast.Paragraph) + pc.Set(temporaryParagraphKey, nil) + if tmp.Lines().Len() == 0 { + next := heading.NextSibling() + segment = segment.TrimLeftSpace(reader.Source()) + if next == nil || !ast.IsParagraph(next) { + para := ast.NewParagraph() + para.Lines().Append(segment) + heading.Parent().InsertAfter(heading.Parent(), heading, para) + } else { + next.Lines().Unshift(segment) + } + heading.Parent().RemoveChild(heading.Parent(), heading) + } else { + heading.SetPos(tmp.Lines().At(0).Start) + heading.SetLines(tmp.Lines()) + heading.SetBlankPreviousLines(tmp.HasBlankPreviousLines()) + tp := tmp.Parent() + if tp != nil { + tp.RemoveChild(tp, tmp) + } + } + + if b.Attribute { + parseLastLineAttributes(node, reader, pc) + } + + if b.AutoHeadingID { + id, ok := node.AttributeString("id") + if !ok { + generateAutoHeadingID(heading, reader, pc) + } else { + pc.IDs().Put(id.([]byte)) + } + } +} + +func (b *setextHeadingParser) CanInterruptParagraph() bool { + return true +} + +func (b *setextHeadingParser) CanAcceptIndentedLine() bool { + return false +} diff --git a/parser/thematic_break.go b/parser/thematic_break.go new file mode 100644 index 0000000..ea015c8 --- /dev/null +++ b/parser/thematic_break.go @@ -0,0 +1,75 @@ +package parser + +import ( + "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/text" + "github.com/yuin/goldmark/util" +) + +type thematicBreakPraser struct { +} + +var defaultThematicBreakPraser = &thematicBreakPraser{} + +// NewThematicBreakParser returns a new BlockParser that +// parses thematic breaks. +func NewThematicBreakParser() BlockParser { + return defaultThematicBreakPraser +} + +func isThematicBreak(line []byte, offset int) bool { + w, pos := util.IndentWidth(line, offset) + if w > 3 { + return false + } + mark := byte(0) + count := 0 + for i := pos; i < len(line); i++ { + c := line[i] + if util.IsSpace(c) { + continue + } + if mark == 0 { + mark = c + count = 1 + if mark == '*' || mark == '-' || mark == '_' { + continue + } + return false + } + if c != mark { + return false + } + count++ + } + return count > 2 +} + +func (b *thematicBreakPraser) Trigger() []byte { + return []byte{'-', '*', '_'} +} + +func (b *thematicBreakPraser) Open(parent ast.Node, reader text.Reader, pc Context) (ast.Node, State) { + line, _ := reader.PeekLine() + if isThematicBreak(line, reader.LineOffset()) { + reader.AdvanceToEOL() + return ast.NewThematicBreak(), NoChildren + } + return nil, NoChildren +} + +func (b *thematicBreakPraser) Continue(node ast.Node, reader text.Reader, pc Context) State { + return Close +} + +func (b *thematicBreakPraser) Close(node ast.Node, reader text.Reader, pc Context) { + // nothing to do +} + +func (b *thematicBreakPraser) CanInterruptParagraph() bool { + return true +} + +func (b *thematicBreakPraser) CanAcceptIndentedLine() bool { + return false +} diff --git a/renderer/html/html.go b/renderer/html/html.go new file mode 100644 index 0000000..c0b72ce --- /dev/null +++ b/renderer/html/html.go @@ -0,0 +1,962 @@ +// Package html implements renderer that outputs HTMLs. +package html + +import ( + "bytes" + "fmt" + "strconv" + "unicode" + "unicode/utf8" + + "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/renderer" + "github.com/yuin/goldmark/util" +) + +// A Config struct has configurations for the HTML based renderers. +type Config struct { + Writer Writer + HardWraps bool + EastAsianLineBreaks EastAsianLineBreaks + XHTML bool + Unsafe bool +} + +// NewConfig returns a new Config with defaults. +func NewConfig() Config { + return Config{ + Writer: DefaultWriter, + HardWraps: false, + EastAsianLineBreaks: EastAsianLineBreaksNone, + XHTML: false, + Unsafe: false, + } +} + +// SetOption implements renderer.NodeRenderer.SetOption. +func (c *Config) SetOption(name renderer.OptionName, value any) { + switch name { + case optHardWraps: + c.HardWraps = value.(bool) + case optEastAsianLineBreaks: + c.EastAsianLineBreaks = value.(EastAsianLineBreaks) + case optXHTML: + c.XHTML = value.(bool) + case optUnsafe: + c.Unsafe = value.(bool) + case optTextWriter: + c.Writer = value.(Writer) + } +} + +// An Option interface sets options for HTML based renderers. +type Option interface { + SetHTMLOption(*Config) +} + +// TextWriter is an option name used in WithWriter. +const optTextWriter renderer.OptionName = "Writer" + +type withWriter struct { + value Writer +} + +func (o *withWriter) SetConfig(c *renderer.Config) { + c.Options[optTextWriter] = o.value +} + +func (o *withWriter) SetHTMLOption(c *Config) { + c.Writer = o.value +} + +// WithWriter is a functional option that allow you to set the given writer to +// the renderer. +func WithWriter(writer Writer) interface { + renderer.Option + Option +} { + return &withWriter{writer} +} + +// HardWraps is an option name used in WithHardWraps. +const optHardWraps renderer.OptionName = "HardWraps" + +type withHardWraps struct { +} + +func (o *withHardWraps) SetConfig(c *renderer.Config) { + c.Options[optHardWraps] = true +} + +func (o *withHardWraps) SetHTMLOption(c *Config) { + c.HardWraps = true +} + +// WithHardWraps is a functional option that indicates whether softline breaks +// should be rendered as '
    '. +func WithHardWraps() interface { + renderer.Option + Option +} { + return &withHardWraps{} +} + +// EastAsianLineBreaks is an option name used in WithEastAsianLineBreaks. +const optEastAsianLineBreaks renderer.OptionName = "EastAsianLineBreaks" + +// A EastAsianLineBreaks is a style of east asian line breaks. +type EastAsianLineBreaks int + +const ( + //EastAsianLineBreaksNone renders line breaks as it is. + EastAsianLineBreaksNone EastAsianLineBreaks = iota + // EastAsianLineBreaksSimple follows east_asian_line_breaks in Pandoc. + EastAsianLineBreaksSimple + // EastAsianLineBreaksCSS3Draft follows CSS text level3 "Segment Break Transformation Rules" with some enhancements. + EastAsianLineBreaksCSS3Draft +) + +func (b EastAsianLineBreaks) softLineBreak(thisLastRune rune, siblingFirstRune rune) bool { + switch b { + case EastAsianLineBreaksNone: + return false + case EastAsianLineBreaksSimple: + return !(util.IsEastAsianWideRune(thisLastRune) && util.IsEastAsianWideRune(siblingFirstRune)) + case EastAsianLineBreaksCSS3Draft: + return eastAsianLineBreaksCSS3DraftSoftLineBreak(thisLastRune, siblingFirstRune) + } + return false +} + +func eastAsianLineBreaksCSS3DraftSoftLineBreak(thisLastRune rune, siblingFirstRune rune) bool { + // Implements CSS text level3 Segment Break Transformation Rules with some enhancements. + // References: + // - https://www.w3.org/TR/2020/WD-css-text-3-20200429/#line-break-transform + // - https://github.com/w3c/csswg-drafts/issues/5086 + + // Rule1: + // If the character immediately before or immediately after the segment break is + // the zero-width space character (U+200B), then the break is removed, leaving behind the zero-width space. + if thisLastRune == '\u200B' || siblingFirstRune == '\u200B' { + return false + } + + // Rule2: + // Otherwise, if the East Asian Width property of both the character before and after the segment break is + // F, W, or H (not A), and neither side is Hangul, then the segment break is removed. + thisLastRuneEastAsianWidth := util.EastAsianWidth(thisLastRune) + siblingFirstRuneEastAsianWidth := util.EastAsianWidth(siblingFirstRune) + if (thisLastRuneEastAsianWidth == "F" || + thisLastRuneEastAsianWidth == "W" || + thisLastRuneEastAsianWidth == "H") && + (siblingFirstRuneEastAsianWidth == "F" || + siblingFirstRuneEastAsianWidth == "W" || + siblingFirstRuneEastAsianWidth == "H") { + return unicode.Is(unicode.Hangul, thisLastRune) || unicode.Is(unicode.Hangul, siblingFirstRune) + } + + // Rule3: + // Otherwise, if either the character before or after the segment break belongs to + // the space-discarding character set and it is a Unicode Punctuation (P*) or U+3000, + // then the segment break is removed. + if util.IsSpaceDiscardingUnicodeRune(thisLastRune) || + unicode.IsPunct(thisLastRune) || + thisLastRune == '\u3000' || + util.IsSpaceDiscardingUnicodeRune(siblingFirstRune) || + unicode.IsPunct(siblingFirstRune) || + siblingFirstRune == '\u3000' { + return false + } + + // Rule4: + // Otherwise, the segment break is converted to a space (U+0020). + return true +} + +type withEastAsianLineBreaks struct { + eastAsianLineBreaksStyle EastAsianLineBreaks +} + +func (o *withEastAsianLineBreaks) SetConfig(c *renderer.Config) { + c.Options[optEastAsianLineBreaks] = o.eastAsianLineBreaksStyle +} + +func (o *withEastAsianLineBreaks) SetHTMLOption(c *Config) { + c.EastAsianLineBreaks = o.eastAsianLineBreaksStyle +} + +// WithEastAsianLineBreaks is a functional option that indicates whether softline breaks +// between east asian wide characters should be ignored. +func WithEastAsianLineBreaks(e EastAsianLineBreaks) interface { + renderer.Option + Option +} { + return &withEastAsianLineBreaks{e} +} + +// XHTML is an option name used in WithXHTML. +const optXHTML renderer.OptionName = "XHTML" + +type withXHTML struct { +} + +func (o *withXHTML) SetConfig(c *renderer.Config) { + c.Options[optXHTML] = true +} + +func (o *withXHTML) SetHTMLOption(c *Config) { + c.XHTML = true +} + +// WithXHTML is a functional option indicates that nodes should be rendered in +// xhtml instead of HTML5. +func WithXHTML() interface { + Option + renderer.Option +} { + return &withXHTML{} +} + +// Unsafe is an option name used in WithUnsafe. +const optUnsafe renderer.OptionName = "Unsafe" + +type withUnsafe struct { +} + +func (o *withUnsafe) SetConfig(c *renderer.Config) { + c.Options[optUnsafe] = true +} + +func (o *withUnsafe) SetHTMLOption(c *Config) { + c.Unsafe = true +} + +// WithUnsafe is a functional option that renders dangerous contents +// (raw htmls and potentially dangerous links) as it is. +func WithUnsafe() interface { + renderer.Option + Option +} { + return &withUnsafe{} +} + +// A Renderer struct is an implementation of renderer.NodeRenderer that renders +// nodes as (X)HTML. +type Renderer struct { + Config +} + +// NewRenderer returns a new Renderer with given options. +func NewRenderer(opts ...Option) renderer.NodeRenderer { + r := &Renderer{ + Config: NewConfig(), + } + + for _, opt := range opts { + opt.SetHTMLOption(&r.Config) + } + return r +} + +// RegisterFuncs implements NodeRenderer.RegisterFuncs . +func (r *Renderer) RegisterFuncs(reg renderer.NodeRendererFuncRegisterer) { + // blocks + + reg.Register(ast.KindDocument, r.renderDocument) + reg.Register(ast.KindHeading, r.renderHeading) + reg.Register(ast.KindBlockquote, r.renderBlockquote) + reg.Register(ast.KindCodeBlock, r.renderCodeBlock) + reg.Register(ast.KindFencedCodeBlock, r.renderFencedCodeBlock) + reg.Register(ast.KindHTMLBlock, r.renderHTMLBlock) + reg.Register(ast.KindList, r.renderList) + reg.Register(ast.KindListItem, r.renderListItem) + reg.Register(ast.KindParagraph, r.renderParagraph) + reg.Register(ast.KindTextBlock, r.renderTextBlock) + reg.Register(ast.KindThematicBreak, r.renderThematicBreak) + reg.Register(ast.KindLinkReferenceDefinition, func( + _ util.BufWriter, _ []byte, _ ast.Node, _ bool) (ast.WalkStatus, error) { + return ast.WalkSkipChildren, nil + }) + + // inlines + + reg.Register(ast.KindAutoLink, r.renderAutoLink) + reg.Register(ast.KindCodeSpan, r.renderCodeSpan) + reg.Register(ast.KindEmphasis, r.renderEmphasis) + reg.Register(ast.KindImage, r.renderImage) + reg.Register(ast.KindLink, r.renderLink) + reg.Register(ast.KindRawHTML, r.renderRawHTML) + reg.Register(ast.KindText, r.renderText) + reg.Register(ast.KindString, r.renderString) +} + +func (r *Renderer) writeLines(w util.BufWriter, source []byte, n ast.Node) { + l := n.Lines().Len() + for i := range l { + line := n.Lines().At(i) + r.Writer.RawWrite(w, line.Value(source)) + } +} + +// GlobalAttributeFilter defines attribute names which any elements can have. +var GlobalAttributeFilter = util.NewBytesFilterString(`accesskey,autocapitalize,autofocus,class,contenteditable,dir,draggable,enterkeyhint,hidden,id,inert,inputmode,is,itemid,itemprop,itemref,itemscope,itemtype,lang,part,role,slot,spellcheck,style,tabindex,title,translate`) // nolint:lll + +func (r *Renderer) renderDocument( + w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + // nothing to do + return ast.WalkContinue, nil +} + +// HeadingAttributeFilter defines attribute names which heading elements can have. +var HeadingAttributeFilter = GlobalAttributeFilter + +func (r *Renderer) renderHeading( + w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + n := node.(*ast.Heading) + if entering { + _, _ = w.WriteString("') + } else { + _, _ = w.WriteString("\n") + } + return ast.WalkContinue, nil +} + +// BlockquoteAttributeFilter defines attribute names which blockquote elements can have. +var BlockquoteAttributeFilter = GlobalAttributeFilter.ExtendString(`cite`) + +func (r *Renderer) renderBlockquote( + w util.BufWriter, source []byte, n ast.Node, entering bool) (ast.WalkStatus, error) { + if entering { + if n.Attributes() != nil { + _, _ = w.WriteString("') + } else { + _, _ = w.WriteString("
    \n") + } + } else { + _, _ = w.WriteString("
    \n") + } + return ast.WalkContinue, nil +} + +func (r *Renderer) renderCodeBlock(w util.BufWriter, source []byte, n ast.Node, entering bool) (ast.WalkStatus, error) { + if entering { + _, _ = w.WriteString("
    ")
    +		r.writeLines(w, source, n)
    +	} else {
    +		_, _ = w.WriteString("
    \n") + } + return ast.WalkContinue, nil +} + +func (r *Renderer) renderFencedCodeBlock( + w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + n := node.(*ast.FencedCodeBlock) + if entering { + _, _ = w.WriteString("
    ')
    +		r.writeLines(w, source, n)
    +	} else {
    +		_, _ = w.WriteString("
    \n") + } + return ast.WalkContinue, nil +} + +func (r *Renderer) renderHTMLBlock( + w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + n := node.(*ast.HTMLBlock) + if entering { + if r.Unsafe { + l := n.Lines().Len() + for i := range l { + line := n.Lines().At(i) + r.Writer.SecureWrite(w, line.Value(source)) + } + } else { + _, _ = w.WriteString("\n") + } + } else { + if n.HasClosure() { + if r.Unsafe { + closure := n.ClosureLine + r.Writer.SecureWrite(w, closure.Value(source)) + } else { + _, _ = w.WriteString("\n") + } + } + } + return ast.WalkContinue, nil +} + +// ListAttributeFilter defines attribute names which list elements can have. +var ListAttributeFilter = GlobalAttributeFilter.ExtendString(`start,reversed,type`) + +func (r *Renderer) renderList(w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + n := node.(*ast.List) + tag := "ul" + if n.IsOrdered() { + tag = "ol" + } + if entering { + _ = w.WriteByte('<') + _, _ = w.WriteString(tag) + if n.IsOrdered() && n.Start != 1 { + _, _ = fmt.Fprintf(w, " start=\"%d\"", n.Start) + } + if n.Attributes() != nil { + RenderAttributes(w, n, ListAttributeFilter) + } + _, _ = w.WriteString(">\n") + } else { + _, _ = w.WriteString("\n") + } + return ast.WalkContinue, nil +} + +// ListItemAttributeFilter defines attribute names which list item elements can have. +var ListItemAttributeFilter = GlobalAttributeFilter.ExtendString(`value`) + +func (r *Renderer) renderListItem(w util.BufWriter, source []byte, n ast.Node, entering bool) (ast.WalkStatus, error) { + if entering { + if n.Attributes() != nil { + _, _ = w.WriteString("') + } else { + _, _ = w.WriteString("
  • ") + } + fc := n.FirstChild() + if fc != nil { + if _, ok := fc.(*ast.TextBlock); !ok { + _ = w.WriteByte('\n') + } + } + } else { + _, _ = w.WriteString("
  • \n") + } + return ast.WalkContinue, nil +} + +// ParagraphAttributeFilter defines attribute names which paragraph elements can have. +var ParagraphAttributeFilter = GlobalAttributeFilter + +func (r *Renderer) renderParagraph(w util.BufWriter, source []byte, n ast.Node, entering bool) (ast.WalkStatus, error) { + if entering { + if n.Attributes() != nil { + _, _ = w.WriteString("') + } else { + _, _ = w.WriteString("

    ") + } + } else { + _, _ = w.WriteString("

    \n") + } + return ast.WalkContinue, nil +} + +func (r *Renderer) renderTextBlock(w util.BufWriter, source []byte, n ast.Node, entering bool) (ast.WalkStatus, error) { + if !entering { + if n.NextSibling() != nil && n.FirstChild() != nil { + _ = w.WriteByte('\n') + } + } + return ast.WalkContinue, nil +} + +// ThematicAttributeFilter defines attribute names which hr elements can have. +var ThematicAttributeFilter = GlobalAttributeFilter.ExtendString(`align,color,noshade,size,width`) + +func (r *Renderer) renderThematicBreak( + w util.BufWriter, source []byte, n ast.Node, entering bool) (ast.WalkStatus, error) { + if !entering { + return ast.WalkContinue, nil + } + _, _ = w.WriteString("\n") + } else { + _, _ = w.WriteString(">\n") + } + return ast.WalkContinue, nil +} + +// LinkAttributeFilter defines attribute names which link elements can have. +var LinkAttributeFilter = GlobalAttributeFilter.ExtendString(`download,href,lang,media,ping,referrerpolicy,rel,shape,target`) // nolint:lll + +func (r *Renderer) renderAutoLink( + w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + n := node.(*ast.AutoLink) + if !entering { + return ast.WalkContinue, nil + } + _, _ = w.WriteString(`') + } else { + _, _ = w.WriteString(`">`) + } + _, _ = w.Write(util.EscapeHTML(label)) + _, _ = w.WriteString(``) + return ast.WalkContinue, nil +} + +// CodeAttributeFilter defines attribute names which code elements can have. +var CodeAttributeFilter = GlobalAttributeFilter + +func (r *Renderer) renderCodeSpan(w util.BufWriter, source []byte, n ast.Node, entering bool) (ast.WalkStatus, error) { + if entering { + if n.Attributes() != nil { + _, _ = w.WriteString("') + } else { + _, _ = w.WriteString("") + } + for c := n.FirstChild(); c != nil; c = c.NextSibling() { + segment := c.(*ast.Text).Segment + value := segment.Value(source) + if bytes.HasSuffix(value, []byte("\n")) { + r.Writer.RawWrite(w, value[:len(value)-1]) + r.Writer.RawWrite(w, []byte(" ")) + } else { + r.Writer.RawWrite(w, value) + } + } + return ast.WalkSkipChildren, nil + } + _, _ = w.WriteString("") + return ast.WalkContinue, nil +} + +// EmphasisAttributeFilter defines attribute names which emphasis elements can have. +var EmphasisAttributeFilter = GlobalAttributeFilter + +func (r *Renderer) renderEmphasis( + w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + n := node.(*ast.Emphasis) + tag := "em" + if n.Level == 2 { + tag = "strong" + } + if entering { + _ = w.WriteByte('<') + _, _ = w.WriteString(tag) + if n.Attributes() != nil { + RenderAttributes(w, n, EmphasisAttributeFilter) + } + _ = w.WriteByte('>') + } else { + _, _ = w.WriteString("') + } + return ast.WalkContinue, nil +} + +func (r *Renderer) renderLink(w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + n := node.(*ast.Link) + if entering { + _, _ = w.WriteString("') + } else { + _, _ = w.WriteString("") + } + return ast.WalkContinue, nil +} + +// ImageAttributeFilter defines attribute names which image elements can have. +var ImageAttributeFilter = GlobalAttributeFilter.ExtendString(`align,border,crossorigin,decoding,height,importance,intrinsicsize,ismap,loading,referrerpolicy,sizes,srcset,usemap,width`) // nolint: lll + +func (r *Renderer) renderImage(w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + if !entering { + return ast.WalkContinue, nil + } + n := node.(*ast.Image) + _, _ = w.WriteString("`)
+	r.renderTexts(w, source, n)
+	_ = w.WriteByte('") + } else { + _, _ = w.WriteString(">") + } + return ast.WalkSkipChildren, nil +} + +func (r *Renderer) renderRawHTML( + w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + if !entering { + return ast.WalkSkipChildren, nil + } + if r.Unsafe { + n := node.(*ast.RawHTML) + l := n.Segments.Len() + for i := range l { + segment := n.Segments.At(i) + _, _ = w.Write(segment.Value(source)) + } + return ast.WalkSkipChildren, nil + } + _, _ = w.WriteString("") + return ast.WalkSkipChildren, nil +} + +func (r *Renderer) renderText(w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + if !entering { + return ast.WalkContinue, nil + } + n := node.(*ast.Text) + segment := n.Segment + if n.IsRaw() { + r.Writer.RawWrite(w, segment.Value(source)) + } else { + value := segment.Value(source) + r.Writer.Write(w, value) + if n.HardLineBreak() || (n.SoftLineBreak() && r.HardWraps) { + if r.XHTML { + _, _ = w.WriteString("
    \n") + } else { + _, _ = w.WriteString("
    \n") + } + } else if n.SoftLineBreak() { + if r.EastAsianLineBreaks != EastAsianLineBreaksNone && len(value) != 0 { + sibling := node.NextSibling() + if sibling != nil && sibling.Kind() == ast.KindText { + if siblingText := sibling.(*ast.Text).Value(source); len(siblingText) != 0 { + thisLastRune := util.ToRune(value, len(value)-1) + siblingFirstRune, _ := utf8.DecodeRune(siblingText) + if r.EastAsianLineBreaks.softLineBreak(thisLastRune, siblingFirstRune) { + _ = w.WriteByte('\n') + } + } + } + } else { + _ = w.WriteByte('\n') + } + } + } + return ast.WalkContinue, nil +} + +func (r *Renderer) renderString(w util.BufWriter, source []byte, node ast.Node, entering bool) (ast.WalkStatus, error) { + if !entering { + return ast.WalkContinue, nil + } + n := node.(*ast.String) + if n.IsCode() { + _, _ = w.Write(n.Value) + } else { + if n.IsRaw() { + r.Writer.RawWrite(w, n.Value) + } else { + r.Writer.Write(w, n.Value) + } + } + return ast.WalkContinue, nil +} + +func (r *Renderer) renderTexts(w util.BufWriter, source []byte, n ast.Node) { + for c := n.FirstChild(); c != nil; c = c.NextSibling() { + if s, ok := c.(*ast.String); ok { + _, _ = r.renderString(w, source, s, true) + } else if t, ok := c.(*ast.Text); ok { + _, _ = r.renderText(w, source, t, true) + } else { + r.renderTexts(w, source, c) + } + } +} + +var dataPrefix = []byte("data-") + +// RenderAttributes renders given node's attributes. +// You can specify attribute names to render by the filter. +// If filter is nil, RenderAttributes renders all attributes. +func RenderAttributes(w util.BufWriter, node ast.Node, filter util.BytesFilter) { + for _, attr := range node.Attributes() { + if filter != nil && !filter.Contains(attr.Name) { + if !bytes.HasPrefix(attr.Name, dataPrefix) { + continue + } + } + _, _ = w.WriteString(" ") + _, _ = w.Write(attr.Name) + _, _ = w.WriteString(`="`) + // TODO: convert numeric values to strings + var value []byte + switch typed := attr.Value.(type) { + case []byte: + value = typed + case string: + value = util.StringToReadOnlyBytes(typed) + } + _, _ = w.Write(util.EscapeHTML(value)) + _ = w.WriteByte('"') + } +} + +// A Writer interface writes textual contents to a writer. +type Writer interface { + // Write writes the given source to writer with resolving references and unescaping + // backslash escaped characters. + Write(writer util.BufWriter, source []byte) + + // RawWrite writes the given source to writer without resolving references and + // unescaping backslash escaped characters. + RawWrite(writer util.BufWriter, source []byte) + + // SecureWrite writes the given source to writer with replacing insecure characters. + SecureWrite(writer util.BufWriter, source []byte) +} + +var replacementCharacter = []byte("\ufffd") + +// A WriterConfig struct has configurations for the HTML based writers. +type WriterConfig struct { + // EscapedSpace is an option that indicates that a '\' escaped half-space(0x20) should not be rendered. + EscapedSpace bool +} + +// A WriterOption interface sets options for HTML based writers. +type WriterOption func(*WriterConfig) + +// WithEscapedSpace is a WriterOption indicates that a '\' escaped half-space(0x20) should not be rendered. +func WithEscapedSpace() WriterOption { + return func(c *WriterConfig) { + c.EscapedSpace = true + } +} + +type defaultWriter struct { + WriterConfig +} + +// NewWriter returns a new Writer. +func NewWriter(opts ...WriterOption) Writer { + w := &defaultWriter{} + for _, opt := range opts { + opt(&w.WriterConfig) + } + return w +} + +func escapeRune(writer util.BufWriter, r rune) { + if r < 256 { + v := util.EscapeHTMLByte(byte(r)) + if v != nil { + _, _ = writer.Write(v) + return + } + } + _, _ = writer.WriteRune(util.ToValidRune(r)) +} + +func (d *defaultWriter) SecureWrite(writer util.BufWriter, source []byte) { + n := 0 + l := len(source) + for i := range l { + if source[i] == '\u0000' { + _, _ = writer.Write(source[i-n : i]) + n = 0 + _, _ = writer.Write(replacementCharacter) + continue + } + n++ + } + if n != 0 { + _, _ = writer.Write(source[l-n:]) + } +} + +func (d *defaultWriter) RawWrite(writer util.BufWriter, source []byte) { + n := 0 + l := len(source) + for i := range l { + v := util.EscapeHTMLByte(source[i]) + if v != nil { + _, _ = writer.Write(source[i-n : i]) + n = 0 + _, _ = writer.Write(v) + continue + } + n++ + } + if n != 0 { + _, _ = writer.Write(source[l-n:]) + } +} + +func (d *defaultWriter) Write(writer util.BufWriter, source []byte) { + escaped := false + var ok bool + limit := len(source) + n := 0 + for i := 0; i < limit; i++ { + c := source[i] + if escaped { + if util.IsPunct(c) { + d.RawWrite(writer, source[n:i-1]) + n = i + escaped = false + continue + } + if d.EscapedSpace && c == ' ' { + d.RawWrite(writer, source[n:i-1]) + n = i + 1 + escaped = false + continue + } + } + if c == '\x00' { + d.RawWrite(writer, source[n:i]) + d.RawWrite(writer, replacementCharacter) + n = i + 1 + escaped = false + continue + } + if c == '&' { + pos := i + next := i + 1 + if next < limit && source[next] == '#' { + nnext := next + 1 + if nnext < limit { + nc := source[nnext] + // code point like #x22; + if nnext < limit && nc == 'x' || nc == 'X' { + start := nnext + 1 + i, ok = util.ReadWhile(source, [2]int{start, limit}, util.IsHexDecimal) + if ok && i < limit && source[i] == ';' && i-start < 7 { + v, _ := strconv.ParseUint(util.BytesToReadOnlyString(source[start:i]), 16, 32) + d.RawWrite(writer, source[n:pos]) + n = i + 1 + escapeRune(writer, rune(v)) + continue + } + // code point like #1234; + } else if nc >= '0' && nc <= '9' { + start := nnext + i, ok = util.ReadWhile(source, [2]int{start, limit}, util.IsNumeric) + if ok && i < limit && i-start < 8 && source[i] == ';' { + v, _ := strconv.ParseUint(util.BytesToReadOnlyString(source[start:i]), 10, 32) + d.RawWrite(writer, source[n:pos]) + n = i + 1 + escapeRune(writer, rune(v)) + continue + } + } + } + } else { + start := next + i, ok = util.ReadWhile(source, [2]int{start, limit}, util.IsAlphaNumeric) + // entity reference + if ok && i < limit && source[i] == ';' { + name := util.BytesToReadOnlyString(source[start:i]) + entity, ok := util.LookUpHTML5EntityByName(name) + if ok { + d.RawWrite(writer, source[n:pos]) + n = i + 1 + d.RawWrite(writer, entity.Characters) + continue + } + } + } + i = next - 1 + } + if c == '\\' { + escaped = true + continue + } + escaped = false + } + d.RawWrite(writer, source[n:]) +} + +// DefaultWriter is a default instance of the Writer. +var DefaultWriter = NewWriter() + +var bDataImage = []byte("data:image/") +var bPng = []byte("png;") +var bGif = []byte("gif;") +var bJpeg = []byte("jpeg;") +var bWebp = []byte("webp;") +var bSvg = []byte("svg+xml;") +var bJs = []byte("javascript:") +var bVb = []byte("vbscript:") +var bFile = []byte("file:") +var bData = []byte("data:") + +func hasPrefix(s, prefix []byte) bool { + return len(s) >= len(prefix) && bytes.Equal(bytes.ToLower(s[0:len(prefix)]), bytes.ToLower(prefix)) +} + +// IsDangerousURL returns true if the given url seems a potentially dangerous url, +// otherwise false. +func IsDangerousURL(url []byte) bool { + if hasPrefix(url, bDataImage) && len(url) >= 11 { + v := url[11:] + if hasPrefix(v, bPng) || hasPrefix(v, bGif) || + hasPrefix(v, bJpeg) || hasPrefix(v, bWebp) || + hasPrefix(v, bSvg) { + return false + } + return true + } + return hasPrefix(url, bJs) || hasPrefix(url, bVb) || + hasPrefix(url, bFile) || hasPrefix(url, bData) +} diff --git a/renderer/renderer.go b/renderer/renderer.go new file mode 100644 index 0000000..8f1c912 --- /dev/null +++ b/renderer/renderer.go @@ -0,0 +1,174 @@ +// Package renderer renders the given AST to certain formats. +package renderer + +import ( + "bufio" + "io" + "sync" + + "github.com/yuin/goldmark/ast" + "github.com/yuin/goldmark/util" +) + +// A Config struct is a data structure that holds configuration of the Renderer. +type Config struct { + Options map[OptionName]any + NodeRenderers util.PrioritizedSlice +} + +// NewConfig returns a new Config. +func NewConfig() *Config { + return &Config{ + Options: map[OptionName]any{}, + NodeRenderers: util.PrioritizedSlice{}, + } +} + +// An OptionName is a name of the option. +type OptionName string + +// An Option interface is a functional option type for the Renderer. +type Option interface { + SetConfig(*Config) +} + +type withNodeRenderers struct { + value []util.PrioritizedValue +} + +func (o *withNodeRenderers) SetConfig(c *Config) { + c.NodeRenderers = append(c.NodeRenderers, o.value...) +} + +// WithNodeRenderers is a functional option that allow you to add +// NodeRenderers to the renderer. +func WithNodeRenderers(ps ...util.PrioritizedValue) Option { + return &withNodeRenderers{ps} +} + +type withOption struct { + name OptionName + value any +} + +func (o *withOption) SetConfig(c *Config) { + c.Options[o.name] = o.value +} + +// WithOption is a functional option that allow you to set +// an arbitrary option to the parser. +func WithOption(name OptionName, value any) Option { + return &withOption{name, value} +} + +// A SetOptioner interface sets given option to the object. +type SetOptioner interface { + // SetOption sets given option to the object. + // Unacceptable options may be passed. + // Thus implementations must ignore unacceptable options. + SetOption(name OptionName, value any) +} + +// NodeRendererFunc is a function that renders a given node. +type NodeRendererFunc func(writer util.BufWriter, source []byte, n ast.Node, entering bool) (ast.WalkStatus, error) + +// A NodeRenderer interface offers NodeRendererFuncs. +type NodeRenderer interface { + // RendererFuncs registers NodeRendererFuncs to given NodeRendererFuncRegisterer. + RegisterFuncs(NodeRendererFuncRegisterer) +} + +// A NodeRendererFuncRegisterer registers given NodeRendererFunc to this object. +type NodeRendererFuncRegisterer interface { + // Register registers given NodeRendererFunc to this object. + Register(ast.NodeKind, NodeRendererFunc) +} + +// A Renderer interface renders given AST node to given +// writer with given Renderer. +type Renderer interface { + Render(w io.Writer, source []byte, n ast.Node) error + + // AddOptions adds given option to this renderer. + AddOptions(...Option) +} + +type renderer struct { + config *Config + options map[OptionName]any + nodeRendererFuncsTmp map[ast.NodeKind]NodeRendererFunc + maxKind int + nodeRendererFuncs []NodeRendererFunc + initSync sync.Once +} + +// NewRenderer returns a new Renderer with given options. +func NewRenderer(options ...Option) Renderer { + config := NewConfig() + for _, opt := range options { + opt.SetConfig(config) + } + + r := &renderer{ + options: map[OptionName]any{}, + config: config, + nodeRendererFuncsTmp: map[ast.NodeKind]NodeRendererFunc{}, + } + + return r +} + +func (r *renderer) AddOptions(opts ...Option) { + for _, opt := range opts { + opt.SetConfig(r.config) + } +} + +func (r *renderer) Register(kind ast.NodeKind, v NodeRendererFunc) { + r.nodeRendererFuncsTmp[kind] = v + if int(kind) > r.maxKind { + r.maxKind = int(kind) + } +} + +// Render renders the given AST node to the given writer with the given Renderer. +func (r *renderer) Render(w io.Writer, source []byte, n ast.Node) error { + r.initSync.Do(func() { + r.options = r.config.Options + r.config.NodeRenderers.Sort() + l := len(r.config.NodeRenderers) + for i := l - 1; i >= 0; i-- { + v := r.config.NodeRenderers[i] + nr, _ := v.Value.(NodeRenderer) + if se, ok := v.Value.(SetOptioner); ok { + for oname, ovalue := range r.options { + se.SetOption(oname, ovalue) + } + } + nr.RegisterFuncs(r) + } + r.nodeRendererFuncs = make([]NodeRendererFunc, r.maxKind+1) + for kind, nr := range r.nodeRendererFuncsTmp { + r.nodeRendererFuncs[kind] = nr + } + r.config = nil + r.nodeRendererFuncsTmp = nil + }) + writer, ok := w.(util.BufWriter) + if !ok { + writer = bufio.NewWriter(w) + } + err := ast.Walk(n, func(n ast.Node, entering bool) (ast.WalkStatus, error) { + s := ast.WalkStatus(ast.WalkContinue) + var err error + f := r.nodeRendererFuncs[n.Kind()] + if f != nil { + s, err = f(writer, source, n, entering) + } + return s, err + }) + if err != nil { + return err + } + return writer.Flush() +} diff --git a/testutil/testutil.go b/testutil/testutil.go new file mode 100644 index 0000000..2cab2e5 --- /dev/null +++ b/testutil/testutil.go @@ -0,0 +1,405 @@ +// Package testutil provides utilities for unit tests. +package testutil + +import ( + "bufio" + "bytes" + "encoding/hex" + "encoding/json" + "fmt" + "os" + "regexp" + "runtime/debug" + "slices" + "strconv" + "strings" + + "github.com/yuin/goldmark" + "github.com/yuin/goldmark/parser" + "github.com/yuin/goldmark/util" +) + +// TestingT is a subset of the functionality provided by testing.T. +type TestingT interface { + Logf(string, ...any) + Skipf(string, ...any) + Errorf(string, ...any) + FailNow() +} + +// MarkdownTestCase represents a test case. +type MarkdownTestCase struct { + No int + Description string + Options MarkdownTestCaseOptions + Markdown string + Expected string +} + +func source(t *MarkdownTestCase) string { + ret := t.Markdown + if t.Options.Trim { + ret = strings.TrimSpace(ret) + } + if t.Options.EnableEscape { + return string(applyEscapeSequence([]byte(ret))) + } + return ret +} + +func expected(t *MarkdownTestCase) string { + ret := t.Expected + if t.Options.Trim { + ret = strings.TrimSpace(ret) + } + if t.Options.EnableEscape { + return string(applyEscapeSequence([]byte(ret))) + } + return ret +} + +// MarkdownTestCaseOptions represents options for each test case. +type MarkdownTestCaseOptions struct { + EnableEscape bool + Trim bool +} + +const attributeSeparator = "//- - - - - - - - -//" +const caseSeparator = "//= = = = = = = = = = = = = = = = = = = = = = = =//" + +var optionsRegexp = regexp.MustCompile(`(?i)\s*options:(.*)`) + +// ParseCliCaseArg parses -case command line args. +func ParseCliCaseArg() []int { + ret := []int{} + for _, a := range os.Args { + if strings.HasPrefix(a, "case=") { + parts := strings.Split(a, "=") + for _, cas := range strings.Split(parts[1], ",") { + value, err := strconv.Atoi(strings.TrimSpace(cas)) + if err == nil { + ret = append(ret, value) + } + } + } + } + return ret +} + +// DoTestCaseFile runs test cases in a given file. +func DoTestCaseFile(m goldmark.Markdown, filename string, t TestingT, no ...int) { + fp, err := os.Open(filename) + if err != nil { + panic(err) + } + defer func() { + _ = fp.Close() + }() + + scanner := bufio.NewScanner(fp) + c := MarkdownTestCase{ + No: -1, + Description: "", + Options: MarkdownTestCaseOptions{}, + Markdown: "", + Expected: "", + } + cases := []MarkdownTestCase{} + line := 0 + for scanner.Scan() { + line++ + if util.IsBlank([]byte(scanner.Text())) { + continue + } + header := scanner.Text() + c.Description = "" + if strings.Contains(header, ":") { + parts := strings.Split(header, ":") + c.No, err = strconv.Atoi(strings.TrimSpace(parts[0])) + c.Description = strings.Join(parts[1:], ":") + } else { + c.No, err = strconv.Atoi(scanner.Text()) + } + if err != nil { + panic(fmt.Sprintf("%s: invalid case No at line %d", filename, line)) + } + if !scanner.Scan() { + panic(fmt.Sprintf("%s: invalid case at line %d", filename, line)) + } + line++ + matches := optionsRegexp.FindAllStringSubmatch(scanner.Text(), -1) + if len(matches) != 0 { + err = json.Unmarshal([]byte(matches[0][1]), &c.Options) + if err != nil { + panic(fmt.Sprintf("%s: invalid options at line %d", filename, line)) + } + scanner.Scan() + line++ + } + if scanner.Text() != attributeSeparator { + panic(fmt.Sprintf("%s: invalid separator '%s' at line %d", filename, scanner.Text(), line)) + } + buf := []string{} + for scanner.Scan() { + line++ + text := scanner.Text() + if text == attributeSeparator { + break + } + buf = append(buf, text) + } + c.Markdown = strings.Join(buf, "\n") + buf = []string{} + for scanner.Scan() { + line++ + text := scanner.Text() + if text == caseSeparator { + break + } + buf = append(buf, text) + } + c.Expected = strings.Join(buf, "\n") + if len(c.Expected) != 0 { + c.Expected = c.Expected + "\n" + } + shouldAdd := len(no) == 0 + if !shouldAdd { + shouldAdd = slices.Contains(no, c.No) + } + if shouldAdd { + cases = append(cases, c) + } + } + DoTestCases(m, cases, t) +} + +// DoTestCases runs a set of test cases. +func DoTestCases(m goldmark.Markdown, cases []MarkdownTestCase, t TestingT, opts ...parser.ParseOption) { + for _, testCase := range cases { + DoTestCase(m, testCase, t, opts...) + } +} + +// DoTestCase runs a test case. +func DoTestCase(m goldmark.Markdown, testCase MarkdownTestCase, t TestingT, opts ...parser.ParseOption) { + var ok bool + var out bytes.Buffer + defer func() { + description := "" + if len(testCase.Description) != 0 { + description = ": " + testCase.Description + } + if err := recover(); err != nil { + format := `============= case %d%s ================ +Markdown: +----------- +%s + +Expected: +---------- +%s + +Actual +--------- +%v +%s +` + t.Errorf(format, testCase.No, description, source(&testCase), expected(&testCase), err, debug.Stack()) + } else if !ok { + format := `============= case %d%s ================ +Markdown: +----------- +%s + +Expected: +---------- +%s + +Actual +--------- +%s + +Diff +--------- +%s +` + t.Errorf(format, testCase.No, description, source(&testCase), expected(&testCase), out.Bytes(), + DiffPretty([]byte(expected(&testCase)), out.Bytes())) + } + }() + + if err := m.Convert([]byte(source(&testCase)), &out, opts...); err != nil { + panic(err) + } + ok = bytes.Equal(bytes.TrimSpace(out.Bytes()), bytes.TrimSpace([]byte(expected(&testCase)))) +} + +type diffType int + +const ( + diffRemoved diffType = iota + diffAdded + diffNone +) + +type diff struct { + Type diffType + Lines [][]byte +} + +func simpleDiff(v1, v2 []byte) []diff { + return simpleDiffAux( + bytes.Split(v1, []byte("\n")), + bytes.Split(v2, []byte("\n"))) +} + +func simpleDiffAux(v1lines, v2lines [][]byte) []diff { + v1index := map[string][]int{} + for i, line := range v1lines { + key := util.BytesToReadOnlyString(line) + if _, ok := v1index[key]; !ok { + v1index[key] = []int{} + } + v1index[key] = append(v1index[key], i) + } + overlap := map[int]int{} + v1start := 0 + v2start := 0 + length := 0 + for v2pos, line := range v2lines { + newOverlap := map[int]int{} + key := util.BytesToReadOnlyString(line) + if _, ok := v1index[key]; !ok { + v1index[key] = []int{} + } + for _, v1pos := range v1index[key] { + value := 0 + if v1pos != 0 { + if v, ok := overlap[v1pos-1]; ok { + value = v + } + } + newOverlap[v1pos] = value + 1 + if newOverlap[v1pos] > length { + length = newOverlap[v1pos] + v1start = v1pos - length + 1 + v2start = v2pos - length + 1 + } + } + overlap = newOverlap + } + if length == 0 { + diffs := []diff{} + if len(v1lines) != 0 { + diffs = append(diffs, diff{diffRemoved, v1lines}) + } + if len(v2lines) != 0 { + diffs = append(diffs, diff{diffAdded, v2lines}) + } + return diffs + } + diffs := simpleDiffAux(v1lines[:v1start], v2lines[:v2start]) + diffs = append(diffs, diff{diffNone, v2lines[v2start : v2start+length]}) + diffs = append(diffs, simpleDiffAux(v1lines[v1start+length:], + v2lines[v2start+length:])...) + return diffs +} + +// DiffPretty returns pretty formatted diff between given bytes. +func DiffPretty(v1, v2 []byte) []byte { + var b bytes.Buffer + diffs := simpleDiff(v1, v2) + for _, diff := range diffs { + c := " " + switch diff.Type { + case diffAdded: + c = "+" + case diffRemoved: + c = "-" + case diffNone: + c = " " + } + for _, line := range diff.Lines { + if c != " " { + fmt.Fprintf(&b, "%s | %s\n", c, util.VisualizeSpaces(line)) + } else { + fmt.Fprintf(&b, "%s | %s\n", c, line) + } + } + } + return b.Bytes() +} + +func applyEscapeSequence(b []byte) []byte { + result := make([]byte, 0, len(b)) + for i := 0; i < len(b); i++ { + if b[i] == '\\' && i != len(b)-1 { + switch b[i+1] { + case 'a': + result = append(result, '\a') + i++ + continue + case 'b': + result = append(result, '\b') + i++ + continue + case 'f': + result = append(result, '\f') + i++ + continue + case 'n': + result = append(result, '\n') + i++ + continue + case 'r': + result = append(result, '\r') + i++ + continue + case 't': + result = append(result, '\t') + i++ + continue + case 'v': + result = append(result, '\v') + i++ + continue + case '\\': + result = append(result, '\\') + i++ + continue + case 'x': + if len(b) >= i+3 && util.IsHexDecimal(b[i+2]) && util.IsHexDecimal(b[i+3]) { + v, _ := hex.DecodeString(string(b[i+2 : i+4])) + result = append(result, v[0]) + i += 3 + continue + } + case 'u', 'U': + if len(b) > i+2 { + num := []byte{} + for j := i + 2; j < len(b); j++ { + if util.IsHexDecimal(b[j]) { + num = append(num, b[j]) + continue + } + break + } + if len(num) >= 4 && len(num) < 8 { + v, _ := strconv.ParseInt(string(num[:4]), 16, 32) + result = append(result, []byte(string(rune(v)))...) + i += 5 + continue + } + if len(num) >= 8 { + v, _ := strconv.ParseInt(string(num[:8]), 16, 32) + result = append(result, []byte(string(rune(v)))...) + i += 9 + continue + } + } + } + } + result = append(result, b[i]) + } + return result +} diff --git a/testutil/testutil_test.go b/testutil/testutil_test.go new file mode 100644 index 0000000..2000a00 --- /dev/null +++ b/testutil/testutil_test.go @@ -0,0 +1,7 @@ +package testutil + +import "testing" + +// This will fail to compile if the TestingT interface is changed in a way +// that doesn't conform to testing.T. +var _ TestingT = (*testing.T)(nil) diff --git a/text/package.go b/text/package.go new file mode 100644 index 0000000..d241ac6 --- /dev/null +++ b/text/package.go @@ -0,0 +1,2 @@ +// Package text provides functionalities to manipulate texts. +package text diff --git a/text/reader.go b/text/reader.go new file mode 100644 index 0000000..21083dc --- /dev/null +++ b/text/reader.go @@ -0,0 +1,701 @@ +package text + +import ( + "bytes" + "io" + "regexp" + "unicode/utf8" + + "github.com/yuin/goldmark/util" +) + +const invalidValue = -1 + +// EOF indicates the end of file. +const EOF = byte(0xff) + +// A Reader interface provides abstracted method for reading text. +type Reader interface { + io.RuneReader + + // Source returns a source of the reader. + Source() []byte + + // ResetPosition resets positions. + ResetPosition() + + // Peek returns a byte at current position without advancing the internal pointer. + Peek() byte + + // PeekLine returns the current line without advancing the internal pointer. + PeekLine() ([]byte, Segment) + + // PrecendingCharacter returns a character just before current internal pointer. + PrecendingCharacter() rune + + // Value returns a value of the given segment. + Value(Segment) []byte + + // LineOffset returns a distance from the line head to current position. + LineOffset() int + + // Position returns current line number and position. + Position() (int, Segment) + + // SetPosition sets current line number and position. + SetPosition(int, Segment) + + // SetPadding sets padding to the reader. + SetPadding(int) + + // Advance advances the internal pointer. + Advance(int) + + // AdvanceAndSetPadding advances the internal pointer and add padding to the + // reader. + AdvanceAndSetPadding(int, int) + + // AdvanceToEOL advances the internal pointer to the end of line. + // If the line ends with a newline, it will be included in the segment. + // If the line ends with EOF, it will not be included in the segment. + AdvanceToEOL() + + // AdvanceLine advances the internal pointer to the next line head. + AdvanceLine() + + // SkipSpaces skips space characters and returns a non-blank line. + // If it reaches EOF, returns false. + SkipSpaces() (Segment, int, bool) + + // SkipSpaces skips blank lines and returns a non-blank line. + // If it reaches EOF, returns false. + SkipBlankLines() (Segment, int, bool) + + // Match performs regular expression matching to current line. + Match(reg *regexp.Regexp) bool + + // Match performs regular expression searching to current line. + FindSubMatch(reg *regexp.Regexp) [][]byte + + // FindClosure finds corresponding closure. + FindClosure(opener, closer byte, options FindClosureOptions) (*Segments, bool) +} + +// FindClosureOptions is options for Reader.FindClosure. +type FindClosureOptions struct { + // CodeSpan is a flag for the FindClosure. If this is set to true, + // FindClosure ignores closers in codespans. + CodeSpan bool + + // Nesting is a flag for the FindClosure. If this is set to true, + // FindClosure allows nesting. + Nesting bool + + // Newline is a flag for the FindClosure. If this is set to true, + // FindClosure searches for a closer over multiple lines. + Newline bool + + // Advance is a flag for the FindClosure. If this is set to true, + // FindClosure advances pointers when closer is found. + Advance bool +} + +type reader struct { + source []byte + sourceLength int + line int + peekedLine []byte + pos Segment + head int + lineOffset int +} + +// NewReader return a new Reader that can read UTF-8 bytes . +func NewReader(source []byte) Reader { + r := &reader{ + source: source, + sourceLength: len(source), + } + r.ResetPosition() + return r +} + +func (r *reader) FindClosure(opener, closer byte, options FindClosureOptions) (*Segments, bool) { + return findClosureReader(r, opener, closer, options) +} + +func (r *reader) ResetPosition() { + r.line = -1 + r.head = 0 + r.lineOffset = -1 + r.AdvanceLine() +} + +func (r *reader) Source() []byte { + return r.source +} + +func (r *reader) Value(seg Segment) []byte { + return seg.Value(r.source) +} + +func (r *reader) Peek() byte { + if r.pos.Start >= 0 && r.pos.Start < r.sourceLength { + if r.pos.Padding != 0 { + return space[0] + } + return r.source[r.pos.Start] + } + return EOF +} + +func (r *reader) PeekLine() ([]byte, Segment) { + if r.pos.Start >= 0 && r.pos.Start < r.sourceLength { + if r.peekedLine == nil { + r.peekedLine = r.pos.Value(r.Source()) + } + return r.peekedLine, r.pos + } + return nil, r.pos +} + +// io.RuneReader interface. +func (r *reader) ReadRune() (rune, int, error) { + return readRuneReader(r) +} + +func (r *reader) LineOffset() int { + if r.lineOffset < 0 { + v := 0 + for i := r.head; i < r.pos.Start; i++ { + if r.source[i] == '\t' { + v += util.TabWidth(v) + } else { + v++ + } + } + r.lineOffset = v - r.pos.Padding + } + return r.lineOffset +} + +func (r *reader) PrecendingCharacter() rune { + if r.pos.Start <= 0 { + if r.pos.Padding != 0 { + return rune(' ') + } + return rune('\n') + } + i := r.pos.Start - 1 + for ; i >= 0; i-- { + if utf8.RuneStart(r.source[i]) { + break + } + } + rn, _ := utf8.DecodeRune(r.source[i:]) + return rn +} + +func (r *reader) Advance(n int) { + r.lineOffset = -1 + if n < len(r.peekedLine) && r.pos.Padding == 0 { + r.pos.Start += n + r.peekedLine = nil + return + } + r.peekedLine = nil + l := r.sourceLength + for ; n > 0 && r.pos.Start < l; n-- { + if r.pos.Padding != 0 { + r.pos.Padding-- + continue + } + if r.source[r.pos.Start] == '\n' { + r.AdvanceLine() + continue + } + r.pos.Start++ + } +} + +func (r *reader) AdvanceAndSetPadding(n, padding int) { + r.Advance(n) + if padding > r.pos.Padding { + r.SetPadding(padding) + } +} + +func (r *reader) AdvanceToEOL() { + if r.pos.Start >= r.sourceLength { + return + } + + r.lineOffset = -1 + i := -1 + if r.peekedLine != nil { + r.pos.Start += len(r.peekedLine) - r.pos.Padding - 1 + if r.source[r.pos.Start] == '\n' { + i = 0 + } + } + if i == -1 { + i = bytes.IndexByte(r.source[r.pos.Start:], '\n') + } + r.peekedLine = nil + if i != -1 { + r.pos.Start += i + } else { + r.pos.Start = r.sourceLength + } + r.pos.Padding = 0 +} + +func (r *reader) AdvanceLine() { + r.lineOffset = -1 + r.peekedLine = nil + r.pos.Start = r.pos.Stop + r.head = r.pos.Start + if r.pos.Start < 0 || r.pos.Start >= r.sourceLength { + return + } + r.pos.Stop = r.sourceLength + i := 0 + if r.source[r.pos.Start] != '\n' { + i = bytes.IndexByte(r.source[r.pos.Start:], '\n') + } + if i != -1 { + r.pos.Stop = r.pos.Start + i + 1 + } + r.line++ + r.pos.Padding = 0 +} + +func (r *reader) Position() (int, Segment) { + return r.line, r.pos +} + +func (r *reader) SetPosition(line int, pos Segment) { + r.lineOffset = -1 + r.line = line + r.pos = pos +} + +func (r *reader) SetPadding(v int) { + r.pos.Padding = v +} + +func (r *reader) SkipSpaces() (Segment, int, bool) { + return skipSpacesReader(r) +} + +func (r *reader) SkipBlankLines() (Segment, int, bool) { + return skipBlankLinesReader(r) +} + +func (r *reader) Match(reg *regexp.Regexp) bool { + return matchReader(r, reg) +} + +func (r *reader) FindSubMatch(reg *regexp.Regexp) [][]byte { + return findSubMatchReader(r, reg) +} + +// A BlockReader interface is a reader that is optimized for Blocks. +type BlockReader interface { + Reader + // Reset resets current state and sets new segments to the reader. + Reset(segment *Segments) +} + +type blockReader struct { + source []byte + segments *Segments + segmentsLength int + line int + pos Segment + head int + last int + lineOffset int +} + +// NewBlockReader returns a new BlockReader. +func NewBlockReader(source []byte, segments *Segments) BlockReader { + r := &blockReader{ + source: source, + } + if segments != nil { + r.Reset(segments) + } + return r +} + +func (r *blockReader) FindClosure(opener, closer byte, options FindClosureOptions) (*Segments, bool) { + return findClosureReader(r, opener, closer, options) +} + +func (r *blockReader) ResetPosition() { + r.line = -1 + r.head = 0 + r.last = 0 + r.lineOffset = -1 + r.pos.Start = -1 + r.pos.Stop = -1 + r.pos.Padding = 0 + if r.segmentsLength > 0 { + last := r.segments.At(r.segmentsLength - 1) + r.last = last.Stop + } + r.AdvanceLine() +} + +func (r *blockReader) Reset(segments *Segments) { + r.segments = segments + r.segmentsLength = segments.Len() + r.ResetPosition() +} + +func (r *blockReader) Source() []byte { + return r.source +} + +func (r *blockReader) Value(seg Segment) []byte { + line := r.segmentsLength - 1 + ret := make([]byte, 0, seg.Stop-seg.Start+1) + for ; line >= 0; line-- { + if seg.Start >= r.segments.At(line).Start { + break + } + } + i := seg.Start + for ; line < r.segmentsLength; line++ { + s := r.segments.At(line) + if i < 0 { + i = s.Start + } + ret = s.ConcatPadding(ret) + for ; i < seg.Stop && i < s.Stop; i++ { + ret = append(ret, r.source[i]) + } + i = -1 + if s.Stop > seg.Stop { + break + } + } + return ret +} + +// io.RuneReader interface. +func (r *blockReader) ReadRune() (rune, int, error) { + return readRuneReader(r) +} + +func (r *blockReader) PrecendingCharacter() rune { + if r.pos.Padding != 0 { + return rune(' ') + } + if r.segments.Len() < 1 { + return rune('\n') + } + firstSegment := r.segments.At(0) + if r.line == 0 && r.pos.Start <= firstSegment.Start { + return rune('\n') + } + l := len(r.source) + i := r.pos.Start - 1 + for ; i < l && i >= 0; i-- { + if utf8.RuneStart(r.source[i]) { + break + } + } + if i < 0 || i >= l { + return rune('\n') + } + rn, _ := utf8.DecodeRune(r.source[i:]) + return rn +} + +func (r *blockReader) LineOffset() int { + if r.lineOffset < 0 { + v := 0 + for i := r.head; i < r.pos.Start; i++ { + if r.source[i] == '\t' { + v += util.TabWidth(v) + } else { + v++ + } + } + r.lineOffset = v - r.pos.Padding + } + return r.lineOffset +} + +func (r *blockReader) Peek() byte { + if r.line < r.segmentsLength && r.pos.Start >= 0 && r.pos.Start < r.last { + if r.pos.Padding != 0 { + return space[0] + } + return r.source[r.pos.Start] + } + return EOF +} + +func (r *blockReader) PeekLine() ([]byte, Segment) { + if r.line < r.segmentsLength && r.pos.Start >= 0 && r.pos.Start < r.last { + return r.pos.Value(r.source), r.pos + } + return nil, r.pos +} + +func (r *blockReader) Advance(n int) { + r.lineOffset = -1 + + if n < r.pos.Stop-r.pos.Start && r.pos.Padding == 0 { + r.pos.Start += n + return + } + + for ; n > 0; n-- { + if r.pos.Padding != 0 { + r.pos.Padding-- + continue + } + if r.pos.Start >= r.pos.Stop-1 && r.pos.Stop < r.last { + r.AdvanceLine() + continue + } + r.pos.Start++ + } +} + +func (r *blockReader) AdvanceAndSetPadding(n, padding int) { + r.Advance(n) + if padding > r.pos.Padding { + r.SetPadding(padding) + } +} + +func (r *blockReader) AdvanceToEOL() { + r.lineOffset = -1 + r.pos.Padding = 0 + c := r.source[r.pos.Stop-1] + if c == '\n' { + r.pos.Start = r.pos.Stop - 1 + } else { + r.pos.Start = r.pos.Stop + } +} + +func (r *blockReader) AdvanceLine() { + r.SetPosition(r.line+1, NewSegment(invalidValue, invalidValue)) + r.head = r.pos.Start +} + +func (r *blockReader) Position() (int, Segment) { + return r.line, r.pos +} + +func (r *blockReader) SetPosition(line int, pos Segment) { + r.lineOffset = -1 + r.line = line + if pos.Start == invalidValue { + if r.line < r.segmentsLength { + s := r.segments.At(line) + r.head = s.Start + r.pos = s + } + } else { + r.pos = pos + if r.line < r.segmentsLength { + s := r.segments.At(line) + r.head = s.Start + } + } +} + +func (r *blockReader) SetPadding(v int) { + r.lineOffset = -1 + r.pos.Padding = v +} + +func (r *blockReader) SkipSpaces() (Segment, int, bool) { + return skipSpacesReader(r) +} + +func (r *blockReader) SkipBlankLines() (Segment, int, bool) { + return skipBlankLinesReader(r) +} + +func (r *blockReader) Match(reg *regexp.Regexp) bool { + return matchReader(r, reg) +} + +func (r *blockReader) FindSubMatch(reg *regexp.Regexp) [][]byte { + return findSubMatchReader(r, reg) +} + +func skipBlankLinesReader(r Reader) (Segment, int, bool) { + lines := 0 + for { + line, seg := r.PeekLine() + if line == nil { + return seg, lines, false + } + if util.IsBlank(line) { + lines++ + r.AdvanceLine() + } else { + return seg, lines, true + } + } +} + +func skipSpacesReader(r Reader) (Segment, int, bool) { + chars := 0 + for { + line, segment := r.PeekLine() + if line == nil { + return segment, chars, false + } + for i, c := range line { + if util.IsSpace(c) { + chars++ + r.Advance(1) + continue + } + return segment.WithStart(segment.Start + i + 1), chars, true + } + } +} + +func matchReader(r Reader, reg *regexp.Regexp) bool { + oldline, oldseg := r.Position() + match := reg.FindReaderSubmatchIndex(r) + r.SetPosition(oldline, oldseg) + if match == nil { + return false + } + r.Advance(match[1] - match[0]) + return true +} + +func findSubMatchReader(r Reader, reg *regexp.Regexp) [][]byte { + oldLine, oldSeg := r.Position() + match := reg.FindReaderSubmatchIndex(r) + r.SetPosition(oldLine, oldSeg) + if match == nil { + return nil + } + var bb bytes.Buffer + bb.Grow(match[1] - match[0]) + for i := 0; i < match[1]; { + r, size, _ := readRuneReader(r) + i += size + bb.WriteRune(r) + } + bs := bb.Bytes() + var result [][]byte + for i := 0; i < len(match); i += 2 { + if match[i] < 0 { + result = append(result, []byte{}) + continue + } + result = append(result, bs[match[i]:match[i+1]]) + } + + r.SetPosition(oldLine, oldSeg) + r.Advance(match[1] - match[0]) + return result +} + +func readRuneReader(r Reader) (rune, int, error) { + line, _ := r.PeekLine() + if line == nil { + return 0, 0, io.EOF + } + rn, size := utf8.DecodeRune(line) + if rn == utf8.RuneError { + return 0, 0, io.EOF + } + r.Advance(size) + return rn, size, nil +} + +func findClosureReader(r Reader, opener, closer byte, opts FindClosureOptions) (*Segments, bool) { + opened := 1 + codeSpanOpener := 0 + closed := false + orgline, orgpos := r.Position() + var ret *Segments + + for { + bs, seg := r.PeekLine() + if bs == nil { + goto end + } + i := 0 + for i < len(bs) { + c := bs[i] + if opts.CodeSpan && codeSpanOpener != 0 && c == '`' { + codeSpanCloser := 0 + for ; i < len(bs); i++ { + if bs[i] == '`' { + codeSpanCloser++ + } else { + i-- + break + } + } + if codeSpanCloser == codeSpanOpener { + codeSpanOpener = 0 + } + } else if codeSpanOpener == 0 && c == '\\' && i < len(bs)-1 && util.IsPunct(bs[i+1]) { + i += 2 + continue + } else if opts.CodeSpan && codeSpanOpener == 0 && c == '`' { + for ; i < len(bs); i++ { + if bs[i] == '`' { + codeSpanOpener++ + } else { + i-- + break + } + } + } else if (opts.CodeSpan && codeSpanOpener == 0) || !opts.CodeSpan { + if c == closer { + opened-- + if opened == 0 { + if ret == nil { + ret = NewSegments() + } + ret.Append(seg.WithStop(seg.Start + i)) + r.Advance(i + 1) + closed = true + goto end + } + } else if c == opener { + if !opts.Nesting { + goto end + } + opened++ + } + } + i++ + } + if !opts.Newline { + goto end + } + r.AdvanceLine() + if ret == nil { + ret = NewSegments() + } + ret.Append(seg) + } +end: + if !opts.Advance { + r.SetPosition(orgline, orgpos) + } + if closed { + return ret, true + } + return nil, false +} diff --git a/text/reader_test.go b/text/reader_test.go new file mode 100644 index 0000000..6957b40 --- /dev/null +++ b/text/reader_test.go @@ -0,0 +1,16 @@ +package text + +import ( + "regexp" + "testing" +) + +func TestFindSubMatchReader(t *testing.T) { + s := "微笑" + r := NewReader([]byte(":" + s + ":")) + reg := regexp.MustCompile(`:(\p{L}+):`) + match := r.FindSubMatch(reg) + if len(match) != 2 || string(match[1]) != s { + t.Fatal("no match cjk") + } +} diff --git a/text/segment.go b/text/segment.go new file mode 100644 index 0000000..30655dd --- /dev/null +++ b/text/segment.go @@ -0,0 +1,233 @@ +package text + +import ( + "bytes" + + "github.com/yuin/goldmark/util" +) + +var space = []byte(" ") + +// A Segment struct holds information about source positions. +type Segment struct { + // Start is a start position of the segment. + Start int + + // Stop is a stop position of the segment. + // This value should be excluded. + Stop int + + // Padding is a padding length of the segment. + Padding int + + // ForceNewline is true if the segment should be ended with a newline. + // Some elements(i.e. CodeBlock, FencedCodeBlock) does not trim trailing + // newlines. Spec defines that EOF is treated as a newline, so we need to + // add a newline to the end of the segment if it is not empty. + // + // i.e.: + // + // ```go + // const test = "test" + // + // This code does not close the code block and ends with EOF. In this case, + // we need to add a newline to the end of the last line like `const test = "test"\n`. + ForceNewline bool +} + +// NewSegment return a new Segment. +func NewSegment(start, stop int) Segment { + return Segment{ + Start: start, + Stop: stop, + Padding: 0, + } +} + +// NewSegmentPadding returns a new Segment with the given padding. +func NewSegmentPadding(start, stop, n int) Segment { + return Segment{ + Start: start, + Stop: stop, + Padding: n, + } +} + +// Value returns a value of the segment. +func (t *Segment) Value(buffer []byte) []byte { + var result []byte + if t.Padding == 0 { + result = buffer[t.Start:t.Stop] + } else { + result = make([]byte, 0, t.Padding+t.Stop-t.Start+1) + result = append(result, bytes.Repeat(space, t.Padding)...) + result = append(result, buffer[t.Start:t.Stop]...) + } + if t.ForceNewline && len(result) > 0 && result[len(result)-1] != '\n' { + result = append(result, '\n') + } + return result +} + +// Len returns a length of the segment. +func (t *Segment) Len() int { + return t.Stop - t.Start + t.Padding +} + +// Between returns a segment between this segment and the given segment. +func (t *Segment) Between(other Segment) Segment { + if t.Stop != other.Stop { + panic("invalid state") + } + return NewSegmentPadding( + t.Start, + other.Start, + t.Padding-other.Padding, + ) +} + +// IsEmpty returns true if this segment is empty, otherwise false. +func (t *Segment) IsEmpty() bool { + return t.Start >= t.Stop && t.Padding == 0 +} + +// TrimRightSpace returns a new segment by slicing off all trailing +// space characters. +func (t *Segment) TrimRightSpace(buffer []byte) Segment { + v := buffer[t.Start:t.Stop] + l := util.TrimRightSpaceLength(v) + if l == len(v) { + return NewSegment(t.Start, t.Start) + } + return NewSegmentPadding(t.Start, t.Stop-l, t.Padding) +} + +// TrimLeftSpace returns a new segment by slicing off all leading +// space characters including padding. +func (t *Segment) TrimLeftSpace(buffer []byte) Segment { + v := buffer[t.Start:t.Stop] + l := util.TrimLeftSpaceLength(v) + return NewSegment(t.Start+l, t.Stop) +} + +// TrimLeftSpaceWidth returns a new segment by slicing off leading space +// characters until the given width. +func (t *Segment) TrimLeftSpaceWidth(width int, buffer []byte) Segment { + padding := t.Padding + for ; width > 0; width-- { + if padding == 0 { + break + } + padding-- + } + if width == 0 { + return NewSegmentPadding(t.Start, t.Stop, padding) + } + text := buffer[t.Start:t.Stop] + start := t.Start + for _, c := range text { + if start >= t.Stop-1 || width <= 0 { + break + } + if c == ' ' { + width-- + } else if c == '\t' { + width -= 4 + } else { + break + } + start++ + } + if width < 0 { + padding = width * -1 + } + return NewSegmentPadding(start, t.Stop, padding) +} + +// WithStart returns a new Segment with same value except Start. +func (t *Segment) WithStart(v int) Segment { + return NewSegmentPadding(v, t.Stop, t.Padding) +} + +// WithStop returns a new Segment with same value except Stop. +func (t *Segment) WithStop(v int) Segment { + return NewSegmentPadding(t.Start, v, t.Padding) +} + +// ConcatPadding concats the padding to the given slice. +func (t *Segment) ConcatPadding(v []byte) []byte { + if t.Padding > 0 { + return append(v, bytes.Repeat(space, t.Padding)...) + } + return v +} + +// Segments is a collection of the Segment. +type Segments struct { + values []Segment +} + +// NewSegments return a new Segments. +func NewSegments() *Segments { + return &Segments{ + values: nil, + } +} + +// Append appends the given segment after the tail of the collection. +func (s *Segments) Append(t Segment) { + s.values = append(s.values, t) +} + +// AppendAll appends all elements of given segments after the tail of the collection. +func (s *Segments) AppendAll(t []Segment) { + s.values = append(s.values, t...) +} + +// Len returns the length of the collection. +func (s *Segments) Len() int { + if s.values == nil { + return 0 + } + return len(s.values) +} + +// At returns a segment at the given index. +func (s *Segments) At(i int) Segment { + return s.values[i] +} + +// Set sets the given Segment. +func (s *Segments) Set(i int, v Segment) { + s.values[i] = v +} + +// SetSliced replace the collection with a subsliced value. +func (s *Segments) SetSliced(lo, hi int) { + s.values = s.values[lo:hi] +} + +// Sliced returns a subslice of the collection. +func (s *Segments) Sliced(lo, hi int) []Segment { + return s.values[lo:hi] +} + +// Clear delete all element of the collection. +func (s *Segments) Clear() { + s.values = nil +} + +// Unshift insert the given Segment to head of the collection. +func (s *Segments) Unshift(v Segment) { + s.values = append(s.values[0:1], s.values[0:]...) + s.values[0] = v +} + +// Value returns a string value of the collection. +func (s *Segments) Value(buffer []byte) []byte { + var result []byte + for _, v := range s.values { + result = append(result, v.Value(buffer)...) + } + return result +} diff --git a/util/html5entities.gen.go b/util/html5entities.gen.go new file mode 100644 index 0000000..631a59a --- /dev/null +++ b/util/html5entities.gen.go @@ -0,0 +1,9 @@ +// Code generated by _tools; DO NOT EDIT. +package util +const _html5entitiesLength = 2124 +const _html5entitiesName string = "AEligAMPAacuteAcircAcyAfrAgraveAlphaAmacrAndAogonAopfApplyFunctionAringAscrAssignAtildeAumlBackslashBarvBarwedBcyBecauseBernoullisBetaBfrBopfBreveBscrBumpeqCHcyCOPYCacuteCapCapitalDifferentialDCayleysCcaronCcedilCcircCconintCdotCedillaCenterDotCfrChiCircleDotCircleMinusCirclePlusCircleTimesClockwiseContourIntegralCloseCurlyDoubleQuoteCloseCurlyQuoteColonColoneCongruentConintContourIntegralCopfCoproductCounterClockwiseContourIntegralCrossCscrCupCupCapDDDDotrahdDJcyDScyDZcyDaggerDarrDashvDcaronDcyDelDeltaDfrDiacriticalAcuteDiacriticalDotDiacriticalDoubleAcuteDiacriticalGraveDiacriticalTildeDiamondDifferentialDDopfDotDotDotDotEqualDoubleContourIntegralDoubleDotDoubleDownArrowDoubleLeftArrowDoubleLeftRightArrowDoubleLeftTeeDoubleLongLeftArrowDoubleLongLeftRightArrowDoubleLongRightArrowDoubleRightArrowDoubleRightTeeDoubleUpArrowDoubleUpDownArrowDoubleVerticalBarDownArrowDownArrowBarDownArrowUpArrowDownBreveDownLeftRightVectorDownLeftTeeVectorDownLeftVectorDownLeftVectorBarDownRightTeeVectorDownRightVectorDownRightVectorBarDownTeeDownTeeArrowDownarrowDscrDstrokENGETHEacuteEcaronEcircEcyEdotEfrEgraveElementEmacrEmptySmallSquareEmptyVerySmallSquareEogonEopfEpsilonEqualEqualTildeEquilibriumEscrEsimEtaEumlExistsExponentialEFcyFfrFilledSmallSquareFilledVerySmallSquareFopfForAllFouriertrfFscrGJcyGTGammaGammadGbreveGcedilGcircGcyGdotGfrGgGopfGreaterEqualGreaterEqualLessGreaterFullEqualGreaterGreaterGreaterLessGreaterSlantEqualGreaterTildeGscrGtHARDcyHacekHatHcircHfrHilbertSpaceHopfHorizontalLineHscrHstrokHumpDownHumpHumpEqualIEcyIJligIOcyIacuteIcircIcyIdotIfrIgraveImImacrImaginaryIImpliesIntIntegralIntersectionInvisibleCommaInvisibleTimesIogonIopfIotaIscrItildeIukcyIumlJcircJcyJfrJopfJscrJsercyJukcyKHcyKJcyKappaKcedilKcyKfrKopfKscrLJcyLTLacuteLambdaLangLaplacetrfLarrLcaronLcedilLcyLeftAngleBracketLeftArrowLeftArrowBarLeftArrowRightArrowLeftCeilingLeftDoubleBracketLeftDownTeeVectorLeftDownVectorLeftDownVectorBarLeftFloorLeftRightArrowLeftRightVectorLeftTeeLeftTeeArrowLeftTeeVectorLeftTriangleLeftTriangleBarLeftTriangleEqualLeftUpDownVectorLeftUpTeeVectorLeftUpVectorLeftUpVectorBarLeftVectorLeftVectorBarLeftarrowLeftrightarrowLessEqualGreaterLessFullEqualLessGreaterLessLessLessSlantEqualLessTildeLfrLlLleftarrowLmidotLongLeftArrowLongLeftRightArrowLongRightArrowLongleftarrowLongleftrightarrowLongrightarrowLopfLowerLeftArrowLowerRightArrowLscrLshLstrokLtMapMcyMediumSpaceMellintrfMfrMinusPlusMopfMscrMuNJcyNacuteNcaronNcedilNcyNegativeMediumSpaceNegativeThickSpaceNegativeThinSpaceNegativeVeryThinSpaceNestedGreaterGreaterNestedLessLessNewLineNfrNoBreakNonBreakingSpaceNopfNotNotCongruentNotCupCapNotDoubleVerticalBarNotElementNotEqualNotEqualTildeNotExistsNotGreaterNotGreaterEqualNotGreaterFullEqualNotGreaterGreaterNotGreaterLessNotGreaterSlantEqualNotGreaterTildeNotHumpDownHumpNotHumpEqualNotLeftTriangleNotLeftTriangleBarNotLeftTriangleEqualNotLessNotLessEqualNotLessGreaterNotLessLessNotLessSlantEqualNotLessTildeNotNestedGreaterGreaterNotNestedLessLessNotPrecedesNotPrecedesEqualNotPrecedesSlantEqualNotReverseElementNotRightTriangleNotRightTriangleBarNotRightTriangleEqualNotSquareSubsetNotSquareSubsetEqualNotSquareSupersetNotSquareSupersetEqualNotSubsetNotSubsetEqualNotSucceedsNotSucceedsEqualNotSucceedsSlantEqualNotSucceedsTildeNotSupersetNotSupersetEqualNotTildeNotTildeEqualNotTildeFullEqualNotTildeTildeNotVerticalBarNscrNtildeNuOEligOacuteOcircOcyOdblacOfrOgraveOmacrOmegaOmicronOopfOpenCurlyDoubleQuoteOpenCurlyQuoteOrOscrOslashOtildeOtimesOumlOverBarOverBraceOverBracketOverParenthesisPartialDPcyPfrPhiPiPlusMinusPoincareplanePopfPrPrecedesPrecedesEqualPrecedesSlantEqualPrecedesTildePrimeProductProportionProportionalPscrPsiQUOTQfrQopfQscrRBarrREGRacuteRangRarrRarrtlRcaronRcedilRcyReReverseElementReverseEquilibriumReverseUpEquilibriumRfrRhoRightAngleBracketRightArrowRightArrowBarRightArrowLeftArrowRightCeilingRightDoubleBracketRightDownTeeVectorRightDownVectorRightDownVectorBarRightFloorRightTeeRightTeeArrowRightTeeVectorRightTriangleRightTriangleBarRightTriangleEqualRightUpDownVectorRightUpTeeVectorRightUpVectorRightUpVectorBarRightVectorRightVectorBarRightarrowRopfRoundImpliesRrightarrowRscrRshRuleDelayedSHCHcySHcySOFTcySacuteScScaronScedilScircScySfrShortDownArrowShortLeftArrowShortRightArrowShortUpArrowSigmaSmallCircleSopfSqrtSquareSquareIntersectionSquareSubsetSquareSubsetEqualSquareSupersetSquareSupersetEqualSquareUnionSscrStarSubSubsetSubsetEqualSucceedsSucceedsEqualSucceedsSlantEqualSucceedsTildeSuchThatSumSupSupersetSupersetEqualSupsetTHORNTRADETSHcyTScyTabTauTcaronTcedilTcyTfrThereforeThetaThickSpaceThinSpaceTildeTildeEqualTildeFullEqualTildeTildeTopfTripleDotTscrTstrokUacuteUarrUarrocirUbrcyUbreveUcircUcyUdblacUfrUgraveUmacrUnderBarUnderBraceUnderBracketUnderParenthesisUnionUnionPlusUogonUopfUpArrowUpArrowBarUpArrowDownArrowUpDownArrowUpEquilibriumUpTeeUpTeeArrowUparrowUpdownarrowUpperLeftArrowUpperRightArrowUpsiUpsilonUringUscrUtildeUumlVDashVbarVcyVdashVdashlVeeVerbarVertVerticalBarVerticalLineVerticalSeparatorVerticalTildeVeryThinSpaceVfrVopfVscrVvdashWcircWedgeWfrWopfWscrXfrXiXopfXscrYAcyYIcyYUcyYacuteYcircYcyYfrYopfYscrYumlZHcyZacuteZcaronZcyZdotZeroWidthSpaceZetaZfrZopfZscraacuteabreveacacEacdacircacuteacyaeligafafragravealefsymalephalphaamacramalgampandandandanddandslopeandvangangeangleangmsdangmsdaaangmsdabangmsdacangmsdadangmsdaeangmsdafangmsdagangmsdahangrtangrtvbangrtvbdangsphangstangzarraogonaopfapapEapacirapeapidaposapproxapproxeqaringascrastasympasympeqatildeaumlawconintawintbNotbackcongbackepsilonbackprimebacksimbacksimeqbarveebarwedbarwedgebbrkbbrktbrkbcongbcybdquobecausbecausebemptyvbepsibernoubetabethbetweenbfrbigcapbigcircbigcupbigodotbigoplusbigotimesbigsqcupbigstarbigtriangledownbigtriangleupbiguplusbigveebigwedgebkarowblacklozengeblacksquareblacktriangleblacktriangledownblacktriangleleftblacktrianglerightblankblk12blk14blk34blockbnebnequivbnotbopfbotbottombowtieboxDLboxDRboxDlboxDrboxHboxHDboxHUboxHdboxHuboxULboxURboxUlboxUrboxVboxVHboxVLboxVRboxVhboxVlboxVrboxboxboxdLboxdRboxdlboxdrboxhboxhDboxhUboxhdboxhuboxminusboxplusboxtimesboxuLboxuRboxulboxurboxvboxvHboxvLboxvRboxvhboxvlboxvrbprimebrevebrvbarbscrbsemibsimbsimebsolbsolbbsolhsubbullbulletbumpbumpEbumpebumpeqcacutecapcapandcapbrcupcapcapcapcupcapdotcapscaretcaronccapsccaronccedilccircccupsccupssmcdotcedilcemptyvcentcenterdotcfrchcycheckcheckmarkchicircirEcirccirceqcirclearrowleftcirclearrowrightcircledRcircledScircledastcircledcirccircleddashcirecirfnintcirmidcirscirclubsclubsuitcoloncolonecoloneqcommacommatcompcompfncomplementcomplexescongcongdotconintcopfcoprodcopycopysrcrarrcrosscscrcsubcsubecsupcsupectdotcudarrlcudarrrcueprcuesccularrcularrpcupcupbrcapcupcapcupcupcupdotcuporcupscurarrcurarrmcurlyeqpreccurlyeqsucccurlyveecurlywedgecurrencurvearrowleftcurvearrowrightcuveecuwedcwconintcwintcylctydArrdHardaggerdalethdarrdashdashvdbkarowdblacdcarondcyddddaggerddarrddotseqdegdeltademptyvdfishtdfrdharldharrdiamdiamonddiamondsuitdiamsdiedigammadisindivdividedivideontimesdivonxdjcydlcorndlcropdollardopfdotdoteqdoteqdotdotminusdotplusdotsquaredoublebarwedgedownarrowdowndownarrowsdownharpoonleftdownharpoonrightdrbkarowdrcorndrcropdscrdscydsoldstrokdtdotdtridtrifduarrduhardwangledzcydzigrarreDDoteDoteacuteeasterecaronecirecircecolonecyedoteeefDotefregegraveegsegsdotelelintersellelselsdotemacremptyemptysetemptyvemspemsp13emsp14engenspeogoneopfepareparsleplusepsiepsilonepsiveqcirceqcoloneqsimeqslantgtreqslantlessequalsequestequivequivDDeqvparslerDoterarrescresdotesimetaetheumleuroexclexistexpectationexponentialefallingdotseqfcyfemaleffiligffligfflligffrfiligfjligflatflligfltnsfnoffopfforallforkforkvfpartintfrac12frac13frac14frac15frac16frac18frac23frac25frac34frac35frac38frac45frac56frac58frac78fraslfrownfscrgEgElgacutegammagammadgapgbrevegcircgcygdotgegelgeqgeqqgeqslantgesgesccgesdotgesdotogesdotolgeslgeslesgfrggggggimelgjcyglglEglagljgnEgnapgnapproxgnegneqgneqqgnsimgopfgravegscrgsimgsimegsimlgtgtccgtcirgtdotgtlPargtquestgtrapproxgtrarrgtrdotgtreqlessgtreqqlessgtrlessgtrsimgvertneqqgvnEhArrhairsphalfhamilthardcyharrharrcirharrwhbarhcircheartsheartsuithellipherconhfrhksearowhkswarowhoarrhomththookleftarrowhookrightarrowhopfhorbarhscrhslashhstrokhybullhypheniacuteicicircicyiecyiexcliffifrigraveiiiiiintiiintiinfiniiotaijligimacrimageimaglineimagpartimathimofimpedinincareinfininfintieinodotintintcalintegersintercalintlarhkintprodiocyiogoniopfiotaiprodiquestiscrisinisinEisindotisinsisinsvisinvititildeiukcyiumljcircjcyjfrjmathjopfjscrjsercyjukcykappakappavkcedilkcykfrkgreenkhcykjcykopfkscrlAarrlArrlAtaillBarrlElEglHarlacutelaemptyvlagranlambdalanglangdlanglelaplaquolarrlarrblarrbfslarrfslarrhklarrlplarrpllarrsimlarrtllatlataillatelateslbarrlbbrklbracelbracklbrkelbrksldlbrkslulcaronlcedillceillcublcyldcaldquoldquorldrdharldrusharldshleleftarrowleftarrowtailleftharpoondownleftharpoonupleftleftarrowsleftrightarrowleftrightarrowsleftrightharpoonsleftrightsquigarrowleftthreetimeslegleqleqqleqslantleslescclesdotlesdotolesdotorlesglesgeslessapproxlessdotlesseqgtrlesseqqgtrlessgtrlesssimlfishtlfloorlfrlglgElhardlharulharullhblkljcyllllarrllcornerllhardlltrilmidotlmoustlmoustachelnElnaplnapproxlnelneqlneqqlnsimloangloarrlobrklongleftarrowlongleftrightarrowlongmapstolongrightarrowlooparrowleftlooparrowrightloparlopflopluslotimeslowastlowbarlozlozengelozflparlparltlrarrlrcornerlrharlrhardlrmlrtrilsaquolscrlshlsimlsimelsimglsqblsquolsquorlstrokltltccltcirltdotlthreeltimesltlarrltquestltrParltriltrieltriflurdsharluruharlvertneqqlvnEmDDotmacrmalemaltmaltesemapmapstomapstodownmapstoleftmapstoupmarkermcommamcymdashmeasuredanglemfrmhomicromidmidastmidcirmiddotminusminusbminusdminusdumlcpmldrmnplusmodelsmopfmpmscrmstposmumultimapmumapnGgnGtnGtvnLeftarrownLeftrightarrownLlnLtnLtvnRightarrownVDashnVdashnablanacutenangnapnapEnapidnaposnapproxnaturnaturalnaturalsnbspnbumpnbumpencapncaronncedilncongncongdotncupncyndashneneArrnearhknearrnearrownedotnequivnesearnesimnexistnexistsnfrngEngengeqngeqqngeqslantngesngsimngtngtrnhArrnharrnhparninisnisdnivnjcynlArrnlEnlarrnldrnlenleftarrownleftrightarrownleqnleqqnleqslantnlesnlessnlsimnltnltrinltrienmidnopfnotnotinnotinEnotindotnotinvanotinvbnotinvcnotninotnivanotnivbnotnivcnparnparallelnparslnpartnpolintnprnprcuenprenprecnpreceqnrArrnrarrnrarrcnrarrwnrightarrownrtrinrtrienscnsccuenscenscrnshortmidnshortparallelnsimnsimensimeqnsmidnsparnsqsubensqsupensubnsubEnsubensubsetnsubseteqnsubseteqqnsuccnsucceqnsupnsupEnsupensupsetnsupseteqnsupseteqqntglntildentlgntriangleleftntrianglelefteqntrianglerightntrianglerighteqnunumnumeronumspnvDashnvHarrnvapnvdashnvgenvgtnvinfinnvlArrnvlenvltnvltrienvrArrnvrtrienvsimnwArrnwarhknwarrnwarrownwnearoSoacuteoastocirocircocyodashodblacodivodotodsoldoeligofcirofrogonograveogtohbarohmointolarrolcirolcrossolineoltomacromegaomicronomidominusoopfoparoperpoplusororarrordorderorderofordfordmorigoforororslopeorvoscroslashosolotildeotimesotimesasoumlovbarparparaparallelparsimparslpartpcypercntperiodpermilperppertenkpfrphiphivphmmatphonepipitchforkpivplanckplanckhplankvplusplusacirplusbpluscirplusdoplusdupluseplusmnplussimplustwopmpointintpopfpoundprprEprapprcuepreprecprecapproxpreccurlyeqpreceqprecnapproxprecneqqprecnsimprecsimprimeprimesprnEprnapprnsimprodprofalarproflineprofsurfpropproptoprsimprurelpscrpsipuncspqfrqintqopfqprimeqscrquaternionsquatintquestquesteqquotrAarrrArrrAtailrBarrrHarraceracuteradicraemptyvrangrangdrangerangleraquorarrrarraprarrbrarrbfsrarrcrarrfsrarrhkrarrlprarrplrarrsimrarrtlrarrwratailratiorationalsrbarrrbbrkrbracerbrackrbrkerbrksldrbrkslurcaronrcedilrceilrcubrcyrdcardldharrdquordquorrdshrealrealinerealpartrealsrectregrfishtrfloorrfrrhardrharurharulrhorhovrightarrowrightarrowtailrightharpoondownrightharpoonuprightleftarrowsrightleftharpoonsrightrightarrowsrightsquigarrowrightthreetimesringrisingdotseqrlarrrlharrlmrmoustrmoustachernmidroangroarrrobrkroparropfroplusrotimesrparrpargtrppolintrrarrrsaquorscrrshrsqbrsquorsquorrthreertimesrtrirtriertrifrtriltriruluharrxsacutesbquoscscEscapscaronsccuescescedilscircscnEscnapscnsimscpolintscsimscysdotsdotbsdoteseArrsearhksearrsearrowsectsemiseswarsetminussetmnsextsfrsfrownsharpshchcyshcyshortmidshortparallelshysigmasigmafsigmavsimsimdotsimesimeqsimgsimgEsimlsimlEsimnesimplussimrarrslarrsmallsetminussmashpsmeparslsmidsmilesmtsmtesmtessoftcysolsolbsolbarsopfspadesspadesuitsparsqcapsqcapssqcupsqcupssqsubsqsubesqsubsetsqsubseteqsqsupsqsupesqsupsetsqsupseteqsqusquaresquarfsqufsrarrsscrssetmnssmilesstarfstarstarfstraightepsilonstraightphistrnssubsubEsubdotsubesubedotsubmultsubnEsubnesubplussubrarrsubsetsubseteqsubseteqqsubsetneqsubsetneqqsubsimsubsubsubsupsuccsuccapproxsucccurlyeqsucceqsuccnapproxsuccneqqsuccnsimsuccsimsumsungsupsup1sup2sup3supEsupdotsupdsubsupesupedotsuphsolsuphsubsuplarrsupmultsupnEsupnesupplussupsetsupseteqsupseteqqsupsetneqsupsetneqqsupsimsupsubsupsupswArrswarhkswarrswarrowswnwarszligtargettautbrktcarontcediltcytdottelrectfrthere4thereforethetathetasymthetavthickapproxthicksimthinspthkapthksimthorntildetimestimesbtimesbartimesdtinttoeatoptopbottopcirtopftopforktosatprimetradetriangletriangledowntrianglelefttrianglelefteqtriangleqtrianglerighttrianglerighteqtridottrietriminustriplustrisbtritimetrpeziumtscrtscytshcytstroktwixttwoheadleftarrowtwoheadrightarrowuArruHaruacuteuarrubrcyubreveucircucyudarrudblacudharufishtufrugraveuharluharruhblkulcornulcornerulcropultriumacrumluogonuopfuparrowupdownarrowupharpoonleftupharpoonrightuplusupsiupsihupsilonupuparrowsurcornurcornerurcropuringurtriuscrutdotutildeutriutrifuuarruumluwanglevArrvBarvBarvvDashvangrtvarepsilonvarkappavarnothingvarphivarpivarproptovarrvarrhovarsigmavarsubsetneqvarsubsetneqqvarsupsetneqvarsupsetneqqvarthetavartriangleleftvartrianglerightvcyvdashveeveebarveeeqvellipverbarvertvfrvltrivnsubvnsupvopfvpropvrtrivscrvsubnEvsubnevsupnEvsupnevzigzagwcircwedbarwedgewedgeqweierpwfrwopfwpwrwreathwscrxcapxcircxcupxdtrixfrxhArrxharrxixlArrxlarrxmapxnisxodotxopfxoplusxotimexrArrxrarrxscrxsqcupxuplusxutrixveexwedgeyacuteyacyycircycyyenyfryicyyopfyscryucyyumlzacutezcaronzcyzdotzeetrfzetazfrzhcyzigrarrzopfzscrzwjzwnj" +const _html5entitiesNameIndex = "\x05\x03\x06\x05\x03\x03\x06\x05\x05\x03\x05\x04\x0d\x05\x04\x06\x06\x04\x09\x04\x06\x03\x07\x0a\x04\x03\x04\x05\x04\x06\x04\x04\x06\x03\x14\x07\x06\x06\x05\x07\x04\x07\x09\x03\x03\x09\x0b\x0a\x0b\x18\x15\x0f\x05\x06\x09\x06\x0f\x04\x09\x1f\x05\x04\x03\x06\x02\x08\x04\x04\x04\x06\x04\x05\x06\x03\x03\x05\x03\x10\x0e\x16\x10\x10\x07\x0d\x04\x03\x06\x08\x15\x09\x0f\x0f\x14\x0d\x13\x18\x14\x10\x0e\x0d\x11\x11\x09\x0c\x10\x09\x13\x11\x0e\x11\x12\x0f\x12\x07\x0c\x09\x04\x06\x03\x03\x06\x06\x05\x03\x04\x03\x06\x07\x05\x10\x14\x05\x04\x07\x05\x0a\x0b\x04\x04\x03\x04\x06\x0c\x03\x03\x11\x15\x04\x06\x0a\x04\x04\x02\x05\x06\x06\x06\x05\x03\x04\x03\x02\x04\x0c\x10\x10\x0e\x0b\x11\x0c\x04\x02\x06\x05\x03\x05\x03\x0c\x04\x0e\x04\x06\x0c\x09\x04\x05\x04\x06\x05\x03\x04\x03\x06\x02\x05\x0a\x07\x03\x08\x0c\x0e\x0e\x05\x04\x04\x04\x06\x05\x04\x05\x03\x03\x04\x04\x06\x05\x04\x04\x05\x06\x03\x03\x04\x04\x04\x02\x06\x06\x04\x0a\x04\x06\x06\x03\x10\x09\x0c\x13\x0b\x11\x11\x0e\x11\x09\x0e\x0f\x07\x0c\x0d\x0c\x0f\x11\x10\x0f\x0c\x0f\x0a\x0d\x09\x0e\x10\x0d\x0b\x08\x0e\x09\x03\x02\x0a\x06\x0d\x12\x0e\x0d\x12\x0e\x04\x0e\x0f\x04\x03\x06\x02\x03\x03\x0b\x09\x03\x09\x04\x04\x02\x04\x06\x06\x06\x03\x13\x12\x11\x15\x14\x0e\x07\x03\x07\x10\x04\x03\x0c\x09\x14\x0a\x08\x0d\x09\x0a\x0f\x13\x11\x0e\x14\x0f\x0f\x0c\x0f\x12\x14\x07\x0c\x0e\x0b\x11\x0c\x17\x11\x0b\x10\x15\x11\x10\x13\x15\x0f\x14\x11\x16\x09\x0e\x0b\x10\x15\x10\x0b\x10\x08\x0d\x11\x0d\x0e\x04\x06\x02\x05\x06\x05\x03\x06\x03\x06\x05\x05\x07\x04\x14\x0e\x02\x04\x06\x06\x06\x04\x07\x09\x0b\x0f\x08\x03\x03\x03\x02\x09\x0d\x04\x02\x08\x0d\x12\x0d\x05\x07\x0a\x0c\x04\x03\x04\x03\x04\x04\x05\x03\x06\x04\x04\x06\x06\x06\x03\x02\x0e\x12\x14\x03\x03\x11\x0a\x0d\x13\x0c\x12\x12\x0f\x12\x0a\x08\x0d\x0e\x0d\x10\x12\x11\x10\x0d\x10\x0b\x0e\x0a\x04\x0c\x0b\x04\x03\x0b\x06\x04\x06\x06\x02\x06\x06\x05\x03\x03\x0e\x0e\x0f\x0c\x05\x0b\x04\x04\x06\x12\x0c\x11\x0e\x13\x0b\x04\x04\x03\x06\x0b\x08\x0d\x12\x0d\x08\x03\x03\x08\x0d\x06\x05\x05\x05\x04\x03\x03\x06\x06\x03\x03\x09\x05\x0a\x09\x05\x0a\x0e\x0a\x04\x09\x04\x06\x06\x04\x08\x05\x06\x05\x03\x06\x03\x06\x05\x08\x0a\x0c\x10\x05\x09\x05\x04\x07\x0a\x10\x0b\x0d\x05\x0a\x07\x0b\x0e\x0f\x04\x07\x05\x04\x06\x04\x05\x04\x03\x05\x06\x03\x06\x04\x0b\x0c\x11\x0d\x0d\x03\x04\x04\x06\x05\x05\x03\x04\x04\x03\x02\x04\x04\x04\x04\x04\x06\x05\x03\x03\x04\x04\x04\x04\x06\x06\x03\x04\x0e\x04\x03\x04\x04\x06\x06\x02\x03\x03\x05\x05\x03\x05\x02\x03\x06\x07\x05\x05\x05\x05\x03\x03\x06\x04\x08\x04\x03\x04\x05\x06\x08\x08\x08\x08\x08\x08\x08\x08\x05\x07\x08\x06\x05\x07\x05\x04\x02\x03\x06\x03\x04\x04\x06\x08\x05\x04\x03\x05\x07\x06\x04\x08\x05\x04\x08\x0b\x09\x07\x09\x06\x06\x08\x04\x08\x05\x03\x05\x06\x07\x07\x05\x06\x04\x04\x07\x03\x06\x07\x06\x07\x08\x09\x08\x07\x0f\x0d\x08\x06\x08\x06\x0c\x0b\x0d\x11\x11\x12\x05\x05\x05\x05\x05\x03\x07\x04\x04\x03\x06\x06\x05\x05\x05\x05\x04\x05\x05\x05\x05\x05\x05\x05\x05\x04\x05\x05\x05\x05\x05\x05\x06\x05\x05\x05\x05\x04\x05\x05\x05\x05\x08\x07\x08\x05\x05\x05\x05\x04\x05\x05\x05\x05\x05\x05\x06\x05\x06\x04\x05\x04\x05\x04\x05\x08\x04\x06\x04\x05\x05\x06\x06\x03\x06\x08\x06\x06\x06\x04\x05\x05\x05\x06\x06\x05\x05\x07\x04\x05\x07\x04\x09\x03\x04\x05\x09\x03\x03\x04\x04\x06\x0f\x10\x08\x08\x0a\x0b\x0b\x04\x08\x06\x07\x05\x08\x05\x06\x07\x05\x06\x04\x06\x0a\x09\x04\x07\x06\x04\x06\x04\x06\x05\x05\x04\x04\x05\x04\x05\x05\x07\x07\x05\x05\x06\x07\x03\x08\x06\x06\x06\x05\x04\x06\x07\x0b\x0b\x08\x0a\x06\x0e\x0f\x05\x05\x08\x05\x06\x04\x04\x06\x06\x04\x04\x05\x07\x05\x06\x03\x02\x07\x05\x07\x03\x05\x07\x06\x03\x05\x05\x04\x07\x0b\x05\x03\x07\x05\x03\x06\x0d\x06\x04\x06\x06\x06\x04\x03\x05\x08\x08\x07\x09\x0e\x09\x0e\x0f\x10\x08\x06\x06\x04\x04\x04\x06\x05\x04\x05\x05\x05\x07\x04\x08\x05\x04\x06\x06\x06\x04\x05\x06\x03\x04\x02\x05\x03\x02\x06\x03\x06\x02\x08\x03\x03\x06\x05\x05\x08\x06\x04\x06\x06\x03\x04\x05\x04\x04\x06\x05\x04\x07\x05\x06\x07\x05\x0a\x0b\x06\x06\x05\x07\x08\x05\x05\x04\x05\x04\x03\x03\x04\x04\x04\x05\x0b\x0c\x0d\x03\x06\x06\x05\x06\x03\x05\x05\x04\x05\x05\x04\x04\x06\x04\x05\x08\x06\x06\x06\x06\x06\x06\x06\x06\x06\x06\x06\x06\x06\x06\x06\x05\x05\x04\x02\x03\x06\x05\x06\x03\x06\x05\x03\x04\x02\x03\x03\x04\x08\x03\x05\x06\x07\x08\x04\x06\x03\x02\x03\x05\x04\x02\x03\x03\x03\x03\x04\x08\x03\x04\x05\x05\x04\x05\x04\x04\x05\x05\x02\x04\x05\x05\x06\x07\x09\x06\x06\x09\x0a\x07\x06\x09\x04\x04\x06\x04\x06\x06\x04\x07\x05\x04\x05\x06\x09\x06\x06\x03\x08\x08\x05\x06\x0d\x0e\x04\x06\x04\x06\x06\x06\x06\x06\x02\x05\x03\x04\x05\x03\x03\x06\x02\x06\x05\x06\x05\x05\x05\x05\x08\x08\x05\x04\x05\x02\x06\x05\x08\x06\x03\x06\x08\x08\x08\x07\x04\x05\x04\x04\x05\x06\x04\x04\x05\x07\x05\x06\x05\x02\x06\x05\x04\x05\x03\x03\x05\x04\x04\x06\x05\x05\x06\x06\x03\x03\x06\x04\x04\x04\x04\x05\x04\x06\x05\x02\x03\x04\x06\x08\x06\x06\x04\x05\x06\x03\x05\x04\x05\x07\x06\x06\x06\x06\x07\x06\x03\x06\x04\x05\x05\x05\x06\x06\x05\x07\x07\x06\x06\x05\x04\x03\x04\x05\x06\x07\x08\x04\x02\x09\x0d\x0f\x0d\x0e\x0e\x0f\x11\x13\x0e\x03\x03\x04\x08\x03\x05\x06\x07\x08\x04\x06\x0a\x07\x09\x0a\x07\x07\x06\x06\x03\x02\x03\x05\x05\x06\x05\x04\x02\x05\x08\x06\x05\x06\x06\x0a\x03\x04\x08\x03\x04\x05\x05\x05\x05\x05\x0d\x12\x0a\x0e\x0d\x0e\x05\x04\x06\x07\x06\x06\x03\x07\x04\x04\x06\x05\x08\x05\x06\x03\x05\x06\x04\x03\x04\x05\x05\x04\x05\x06\x06\x02\x04\x05\x05\x06\x06\x06\x07\x06\x04\x05\x05\x08\x07\x09\x04\x05\x04\x04\x04\x07\x03\x06\x0a\x0a\x08\x06\x06\x03\x05\x0d\x03\x03\x05\x03\x06\x06\x06\x05\x06\x06\x07\x04\x04\x06\x06\x04\x02\x04\x06\x02\x08\x05\x03\x03\x04\x0a\x0f\x03\x03\x04\x0b\x06\x06\x05\x06\x04\x03\x04\x05\x05\x07\x05\x07\x08\x04\x05\x06\x04\x06\x06\x05\x08\x04\x03\x05\x02\x05\x06\x05\x07\x05\x06\x06\x05\x06\x07\x03\x03\x03\x04\x05\x09\x04\x05\x03\x04\x05\x05\x05\x02\x03\x04\x03\x04\x05\x03\x05\x04\x03\x0a\x0f\x04\x05\x09\x04\x05\x05\x03\x05\x06\x04\x04\x03\x05\x06\x08\x07\x07\x07\x05\x07\x07\x07\x04\x09\x06\x05\x07\x03\x06\x04\x05\x07\x05\x05\x06\x06\x0b\x05\x06\x03\x06\x04\x04\x09\x0e\x04\x05\x06\x05\x05\x07\x07\x04\x05\x05\x07\x09\x0a\x05\x07\x04\x05\x05\x07\x09\x0a\x04\x06\x04\x0d\x0f\x0e\x10\x02\x03\x06\x05\x06\x06\x04\x06\x04\x04\x07\x06\x04\x04\x07\x06\x07\x05\x05\x06\x05\x07\x06\x02\x06\x04\x04\x05\x03\x05\x06\x04\x04\x06\x05\x05\x03\x04\x06\x03\x05\x03\x04\x05\x05\x07\x05\x03\x05\x05\x07\x04\x06\x04\x04\x05\x05\x02\x05\x03\x05\x07\x04\x04\x06\x04\x07\x03\x04\x06\x04\x06\x06\x08\x04\x05\x03\x04\x08\x06\x05\x04\x03\x06\x06\x06\x04\x07\x03\x03\x04\x06\x05\x02\x09\x03\x06\x07\x06\x04\x08\x05\x07\x06\x06\x05\x06\x07\x07\x02\x08\x04\x05\x02\x03\x04\x05\x03\x04\x0a\x0b\x06\x0b\x08\x08\x07\x05\x06\x04\x05\x06\x04\x08\x08\x08\x04\x06\x05\x06\x04\x03\x06\x03\x04\x04\x06\x04\x0b\x07\x05\x07\x04\x05\x04\x06\x05\x04\x04\x06\x05\x08\x04\x05\x05\x06\x05\x04\x06\x05\x07\x05\x06\x06\x06\x06\x07\x06\x05\x06\x05\x09\x05\x05\x06\x06\x05\x07\x07\x06\x06\x05\x04\x03\x04\x07\x05\x06\x04\x04\x07\x08\x05\x04\x03\x06\x06\x03\x05\x05\x06\x03\x04\x0a\x0e\x10\x0e\x0f\x11\x10\x0f\x0f\x04\x0c\x05\x05\x03\x06\x0a\x05\x05\x05\x05\x05\x04\x06\x07\x04\x06\x08\x05\x06\x04\x03\x04\x05\x06\x06\x06\x04\x05\x05\x08\x07\x02\x06\x05\x02\x03\x04\x06\x05\x03\x06\x05\x04\x05\x06\x08\x05\x03\x04\x05\x05\x05\x06\x05\x07\x04\x04\x06\x08\x05\x04\x03\x06\x05\x06\x04\x08\x0d\x03\x05\x06\x06\x03\x06\x04\x05\x04\x05\x04\x05\x05\x07\x07\x05\x0d\x06\x08\x04\x05\x03\x04\x05\x06\x03\x04\x06\x04\x06\x09\x04\x05\x06\x05\x06\x05\x06\x08\x0a\x05\x06\x08\x0a\x03\x06\x06\x04\x05\x04\x06\x06\x06\x04\x05\x0f\x0b\x05\x03\x04\x06\x04\x07\x07\x05\x05\x07\x07\x06\x08\x09\x09\x0a\x06\x06\x06\x04\x0a\x0b\x06\x0b\x08\x08\x07\x03\x04\x03\x04\x04\x04\x04\x06\x07\x04\x07\x07\x07\x07\x07\x05\x05\x07\x06\x08\x09\x09\x0a\x06\x06\x06\x05\x06\x05\x07\x06\x05\x06\x03\x04\x06\x06\x03\x04\x06\x03\x06\x09\x05\x08\x06\x0b\x08\x06\x05\x06\x05\x05\x05\x06\x08\x06\x04\x04\x03\x06\x06\x04\x07\x04\x06\x05\x08\x0c\x0c\x0e\x09\x0d\x0f\x06\x04\x08\x07\x05\x07\x08\x04\x04\x05\x06\x05\x10\x11\x04\x04\x06\x04\x05\x06\x05\x03\x05\x06\x05\x06\x03\x06\x05\x05\x05\x06\x08\x06\x05\x05\x03\x05\x04\x07\x0b\x0d\x0e\x05\x04\x05\x07\x0a\x06\x08\x06\x05\x05\x04\x05\x06\x04\x05\x05\x04\x07\x04\x04\x05\x05\x06\x0a\x08\x0a\x06\x05\x09\x04\x06\x08\x0c\x0d\x0c\x0d\x08\x0f\x10\x03\x05\x03\x06\x05\x06\x06\x04\x03\x05\x05\x05\x04\x05\x05\x04\x06\x06\x06\x06\x07\x05\x06\x05\x06\x06\x03\x04\x02\x02\x06\x04\x04\x05\x04\x05\x03\x05\x05\x02\x05\x05\x04\x04\x05\x04\x06\x06\x05\x05\x04\x06\x06\x05\x04\x06\x06\x04\x05\x03\x03\x03\x04\x04\x04\x04\x04\x06\x06\x03\x04\x06\x04\x03\x04\x07\x04\x04\x03\x04" +var _html5entitiesCodePoints = [...]int{198, 38, 193, 194, 1040, 120068, 192, 913, 256, 10835, 260, 120120, 8289, 197, 119964, 8788, 195, 196, 8726, 10983, 8966, 1041, 8757, 8492, 914, 120069, 120121, 728, 8492, 8782, 1063, 169, 262, 8914, 8517, 8493, 268, 199, 264, 8752, 266, 184, 183, 8493, 935, 8857, 8854, 8853, 8855, 8754, 8221, 8217, 8759, 10868, 8801, 8751, 8750, 8450, 8720, 8755, 10799, 119966, 8915, 8781, 8517, 10513, 1026, 1029, 1039, 8225, 8609, 10980, 270, 1044, 8711, 916, 120071, 180, 729, 733, 96, 732, 8900, 8518, 120123, 168, 8412, 8784, 8751, 168, 8659, 8656, 8660, 10980, 10232, 10234, 10233, 8658, 8872, 8657, 8661, 8741, 8595, 10515, 8693, 785, 10576, 10590, 8637, 10582, 10591, 8641, 10583, 8868, 8615, 8659, 119967, 272, 330, 208, 201, 282, 202, 1069, 278, 120072, 200, 8712, 274, 9723, 9643, 280, 120124, 917, 10869, 8770, 8652, 8496, 10867, 919, 203, 8707, 8519, 1060, 120073, 9724, 9642, 120125, 8704, 8497, 8497, 1027, 62, 915, 988, 286, 290, 284, 1043, 288, 120074, 8921, 120126, 8805, 8923, 8807, 10914, 8823, 10878, 8819, 119970, 8811, 1066, 711, 94, 292, 8460, 8459, 8461, 9472, 8459, 294, 8782, 8783, 1045, 306, 1025, 205, 206, 1048, 304, 8465, 204, 8465, 298, 8520, 8658, 8748, 8747, 8898, 8291, 8290, 302, 120128, 921, 8464, 296, 1030, 207, 308, 1049, 120077, 120129, 119973, 1032, 1028, 1061, 1036, 922, 310, 1050, 120078, 120130, 119974, 1033, 60, 313, 923, 10218, 8466, 8606, 317, 315, 1051, 10216, 8592, 8676, 8646, 8968, 10214, 10593, 8643, 10585, 8970, 8596, 10574, 8867, 8612, 10586, 8882, 10703, 8884, 10577, 10592, 8639, 10584, 8636, 10578, 8656, 8660, 8922, 8806, 8822, 10913, 10877, 8818, 120079, 8920, 8666, 319, 10229, 10231, 10230, 10232, 10234, 10233, 120131, 8601, 8600, 8466, 8624, 321, 8810, 10501, 1052, 8287, 8499, 120080, 8723, 120132, 8499, 924, 1034, 323, 327, 325, 1053, 8203, 8203, 8203, 8203, 8811, 8810, 10, 120081, 8288, 160, 8469, 10988, 8802, 8813, 8742, 8713, 8800, 877, 24, 8708, 8815, 8817, 880, 24, 881, 24, 8825, 1087, 24, 8821, 878, 24, 878, 24, 8938, 1070, 24, 8940, 8814, 8816, 8824, 881, 24, 1087, 24, 8820, 1091, 24, 1091, 24, 8832, 1092, 24, 8928, 8716, 8939, 1070, 24, 8941, 884, 24, 8930, 884, 24, 8931, 883, 402, 8840, 8833, 1092, 24, 8929, 883, 24, 883, 402, 8841, 8769, 8772, 8775, 8777, 8740, 119977, 209, 925, 338, 211, 212, 1054, 336, 120082, 210, 332, 937, 927, 120134, 8220, 8216, 10836, 119978, 216, 213, 10807, 214, 8254, 9182, 9140, 9180, 8706, 1055, 120083, 934, 928, 177, 8460, 8473, 10939, 8826, 10927, 8828, 8830, 8243, 8719, 8759, 8733, 119979, 936, 34, 120084, 8474, 119980, 10512, 174, 340, 10219, 8608, 10518, 344, 342, 1056, 8476, 8715, 8651, 10607, 8476, 929, 10217, 8594, 8677, 8644, 8969, 10215, 10589, 8642, 10581, 8971, 8866, 8614, 10587, 8883, 10704, 8885, 10575, 10588, 8638, 10580, 8640, 10579, 8658, 8477, 10608, 8667, 8475, 8625, 10740, 1065, 1064, 1068, 346, 10940, 352, 350, 348, 1057, 120086, 8595, 8592, 8594, 8593, 931, 8728, 120138, 8730, 9633, 8851, 8847, 8849, 8848, 8850, 8852, 119982, 8902, 8912, 8912, 8838, 8827, 10928, 8829, 8831, 8715, 8721, 8913, 8835, 8839, 8913, 222, 8482, 1035, 1062, 9, 932, 356, 354, 1058, 120087, 8756, 920, 828, 202, 8201, 8764, 8771, 8773, 8776, 120139, 8411, 119983, 358, 218, 8607, 10569, 1038, 364, 219, 1059, 368, 120088, 217, 362, 95, 9183, 9141, 9181, 8899, 8846, 370, 120140, 8593, 10514, 8645, 8597, 10606, 8869, 8613, 8657, 8661, 8598, 8599, 978, 933, 366, 119984, 360, 220, 8875, 10987, 1042, 8873, 10982, 8897, 8214, 8214, 8739, 124, 10072, 8768, 8202, 120089, 120141, 119985, 8874, 372, 8896, 120090, 120142, 119986, 120091, 926, 120143, 119987, 1071, 1031, 1070, 221, 374, 1067, 120092, 120144, 119988, 376, 1046, 377, 381, 1047, 379, 8203, 918, 8488, 8484, 119989, 225, 259, 8766, 876, 19, 8767, 226, 180, 1072, 230, 8289, 120094, 224, 8501, 8501, 945, 257, 10815, 38, 8743, 10837, 10844, 10840, 10842, 8736, 10660, 8736, 8737, 10664, 10665, 10666, 10667, 10668, 10669, 10670, 10671, 8735, 8894, 10653, 8738, 197, 9084, 261, 120146, 8776, 10864, 10863, 8778, 8779, 39, 8776, 8778, 229, 119990, 42, 8776, 8781, 227, 228, 8755, 10769, 10989, 8780, 1014, 8245, 8765, 8909, 8893, 8965, 8965, 9141, 9142, 8780, 1073, 8222, 8757, 8757, 10672, 1014, 8492, 946, 8502, 8812, 120095, 8898, 9711, 8899, 10752, 10753, 10754, 10758, 9733, 9661, 9651, 10756, 8897, 8896, 10509, 10731, 9642, 9652, 9662, 9666, 9656, 9251, 9618, 9617, 9619, 9608, 6, 421, 880, 421, 8976, 120147, 8869, 8869, 8904, 9559, 9556, 9558, 9555, 9552, 9574, 9577, 9572, 9575, 9565, 9562, 9564, 9561, 9553, 9580, 9571, 9568, 9579, 9570, 9567, 10697, 9557, 9554, 9488, 9484, 9472, 9573, 9576, 9516, 9524, 8863, 8862, 8864, 9563, 9560, 9496, 9492, 9474, 9578, 9569, 9566, 9532, 9508, 9500, 8245, 728, 166, 119991, 8271, 8765, 8909, 92, 10693, 10184, 8226, 8226, 8782, 10926, 8783, 8783, 263, 8745, 10820, 10825, 10827, 10823, 10816, 874, 5024, 8257, 711, 10829, 269, 231, 265, 10828, 10832, 267, 184, 10674, 162, 183, 120096, 1095, 10003, 10003, 967, 9675, 10691, 710, 8791, 8634, 8635, 174, 9416, 8859, 8858, 8861, 8791, 10768, 10991, 10690, 9827, 9827, 58, 8788, 8788, 44, 64, 8705, 8728, 8705, 8450, 8773, 10861, 8750, 120148, 8720, 169, 8471, 8629, 10007, 119992, 10959, 10961, 10960, 10962, 8943, 10552, 10549, 8926, 8927, 8630, 10557, 8746, 10824, 10822, 10826, 8845, 10821, 874, 5024, 8631, 10556, 8926, 8927, 8910, 8911, 164, 8630, 8631, 8910, 8911, 8754, 8753, 9005, 8659, 10597, 8224, 8504, 8595, 8208, 8867, 10511, 733, 271, 1076, 8518, 8225, 8650, 10871, 176, 948, 10673, 10623, 120097, 8643, 8642, 8900, 8900, 9830, 9830, 168, 989, 8946, 247, 247, 8903, 8903, 1106, 8990, 8973, 36, 120149, 729, 8784, 8785, 8760, 8724, 8865, 8966, 8595, 8650, 8643, 8642, 10512, 8991, 8972, 119993, 1109, 10742, 273, 8945, 9663, 9662, 8693, 10607, 10662, 1119, 10239, 10871, 8785, 233, 10862, 283, 8790, 234, 8789, 1101, 279, 8519, 8786, 120098, 10906, 232, 10902, 10904, 10905, 9191, 8467, 10901, 10903, 275, 8709, 8709, 8709, 8195, 8196, 8197, 331, 8194, 281, 120150, 8917, 10723, 10865, 949, 949, 1013, 8790, 8789, 8770, 10902, 10901, 61, 8799, 8801, 10872, 10725, 8787, 10609, 8495, 8784, 8770, 951, 240, 235, 8364, 33, 8707, 8496, 8519, 8786, 1092, 9792, 64259, 64256, 64260, 120099, 64257, 10, 06, 9837, 64258, 9649, 402, 120151, 8704, 8916, 10969, 10765, 189, 8531, 188, 8533, 8537, 8539, 8532, 8534, 190, 8535, 8540, 8536, 8538, 8541, 8542, 8260, 8994, 119995, 8807, 10892, 501, 947, 989, 10886, 287, 285, 1075, 289, 8805, 8923, 8805, 8807, 10878, 10878, 10921, 10880, 10882, 10884, 892, 5024, 10900, 120100, 8811, 8921, 8503, 1107, 8823, 10898, 10917, 10916, 8809, 10890, 10890, 10888, 10888, 8809, 8935, 120152, 96, 8458, 8819, 10894, 10896, 62, 10919, 10874, 8919, 10645, 10876, 10886, 10616, 8919, 8923, 10892, 8823, 8819, 880, 5024, 880, 5024, 8660, 8202, 189, 8459, 1098, 8596, 10568, 8621, 8463, 293, 9829, 9829, 8230, 8889, 120101, 10533, 10534, 8703, 8763, 8617, 8618, 120153, 8213, 119997, 8463, 295, 8259, 8208, 237, 8291, 238, 1080, 1077, 161, 8660, 120102, 236, 8520, 10764, 8749, 10716, 8489, 307, 299, 8465, 8464, 8465, 305, 8887, 437, 8712, 8453, 8734, 10717, 305, 8747, 8890, 8484, 8890, 10775, 10812, 1105, 303, 120154, 953, 10812, 191, 119998, 8712, 8953, 8949, 8948, 8947, 8712, 8290, 297, 1110, 239, 309, 1081, 120103, 567, 120155, 119999, 1112, 1108, 954, 1008, 311, 1082, 120104, 312, 1093, 1116, 120156, 120000, 8666, 8656, 10523, 10510, 8806, 10891, 10594, 314, 10676, 8466, 955, 10216, 10641, 10216, 10885, 171, 8592, 8676, 10527, 10525, 8617, 8619, 10553, 10611, 8610, 10923, 10521, 10925, 1092, 5024, 10508, 10098, 123, 91, 10635, 10639, 10637, 318, 316, 8968, 123, 1083, 10550, 8220, 8222, 10599, 10571, 8626, 8804, 8592, 8610, 8637, 8636, 8647, 8596, 8646, 8651, 8621, 8907, 8922, 8804, 8806, 10877, 10877, 10920, 10879, 10881, 10883, 892, 5024, 10899, 10885, 8918, 8922, 10891, 8822, 8818, 10620, 8970, 120105, 8822, 10897, 8637, 8636, 10602, 9604, 1113, 8810, 8647, 8990, 10603, 9722, 320, 9136, 9136, 8808, 10889, 10889, 10887, 10887, 8808, 8934, 10220, 8701, 10214, 10229, 10231, 10236, 10230, 8619, 8620, 10629, 120157, 10797, 10804, 8727, 95, 9674, 9674, 10731, 40, 10643, 8646, 8991, 8651, 10605, 8206, 8895, 8249, 120001, 8624, 8818, 10893, 10895, 91, 8216, 8218, 322, 60, 10918, 10873, 8918, 8907, 8905, 10614, 10875, 10646, 9667, 8884, 9666, 10570, 10598, 880, 5024, 880, 5024, 8762, 175, 9794, 10016, 10016, 8614, 8614, 8615, 8612, 8613, 9646, 10793, 1084, 8212, 8737, 120106, 8487, 181, 8739, 42, 10992, 183, 8722, 8863, 8760, 10794, 10971, 8230, 8723, 8871, 120158, 8723, 120002, 8766, 956, 8888, 8888, 892, 24, 881, 402, 881, 24, 8653, 8654, 892, 24, 881, 402, 881, 24, 8655, 8879, 8878, 8711, 324, 873, 402, 8777, 1086, 24, 877, 24, 329, 8777, 9838, 9838, 8469, 160, 878, 24, 878, 24, 10819, 328, 326, 8775, 1086, 24, 10818, 1085, 8211, 8800, 8663, 10532, 8599, 8599, 878, 24, 8802, 10536, 877, 24, 8708, 8708, 120107, 880, 24, 8817, 8817, 880, 24, 1087, 24, 1087, 24, 8821, 8815, 8815, 8654, 8622, 10994, 8715, 8956, 8954, 8715, 1114, 8653, 880, 24, 8602, 8229, 8816, 8602, 8622, 8816, 880, 24, 1087, 24, 1087, 24, 8814, 8820, 8814, 8938, 8940, 8740, 120159, 172, 8713, 895, 24, 894, 24, 8713, 8951, 8950, 8716, 8716, 8958, 8957, 8742, 8742, 1100, 421, 870, 24, 10772, 8832, 8928, 1092, 24, 8832, 1092, 24, 8655, 8603, 1054, 24, 860, 24, 8603, 8939, 8941, 8833, 8929, 1092, 24, 120003, 8740, 8742, 8769, 8772, 8772, 8740, 8742, 8930, 8931, 8836, 1094, 24, 8840, 883, 402, 8840, 1094, 24, 8833, 1092, 24, 8837, 1095, 24, 8841, 883, 402, 8841, 1095, 24, 8825, 241, 8824, 8938, 8940, 8939, 8941, 957, 35, 8470, 8199, 8877, 10500, 878, 402, 8876, 880, 402, 6, 402, 10718, 10498, 880, 402, 6, 402, 888, 402, 10499, 888, 402, 876, 402, 8662, 10531, 8598, 8598, 10535, 9416, 243, 8859, 8858, 244, 1086, 8861, 337, 10808, 8857, 10684, 339, 10687, 120108, 731, 242, 10689, 10677, 937, 8750, 8634, 10686, 10683, 8254, 10688, 333, 969, 959, 10678, 8854, 120160, 10679, 10681, 8853, 8744, 8635, 10845, 8500, 8500, 170, 186, 8886, 10838, 10839, 10843, 8500, 248, 8856, 245, 8855, 10806, 246, 9021, 8741, 182, 8741, 10995, 11005, 8706, 1087, 37, 46, 8240, 8869, 8241, 120109, 966, 981, 8499, 9742, 960, 8916, 982, 8463, 8462, 8463, 43, 10787, 8862, 10786, 8724, 10789, 10866, 177, 10790, 10791, 177, 10773, 120161, 163, 8826, 10931, 10935, 8828, 10927, 8826, 10935, 8828, 10927, 10937, 10933, 8936, 8830, 8242, 8473, 10933, 10937, 8936, 8719, 9006, 8978, 8979, 8733, 8733, 8830, 8880, 120005, 968, 8200, 120110, 10764, 120162, 8279, 120006, 8461, 10774, 63, 8799, 34, 8667, 8658, 10524, 10511, 10596, 876, 17, 341, 8730, 10675, 10217, 10642, 10661, 10217, 187, 8594, 10613, 8677, 10528, 10547, 10526, 8618, 8620, 10565, 10612, 8611, 8605, 10522, 8758, 8474, 10509, 10099, 125, 93, 10636, 10638, 10640, 345, 343, 8969, 125, 1088, 10551, 10601, 8221, 8221, 8627, 8476, 8475, 8476, 8477, 9645, 174, 10621, 8971, 120111, 8641, 8640, 10604, 961, 1009, 8594, 8611, 8641, 8640, 8644, 8652, 8649, 8605, 8908, 730, 8787, 8644, 8652, 8207, 9137, 9137, 10990, 10221, 8702, 10215, 10630, 120163, 10798, 10805, 41, 10644, 10770, 8649, 8250, 120007, 8625, 93, 8217, 8217, 8908, 8906, 9657, 8885, 9656, 10702, 10600, 8478, 347, 8218, 8827, 10932, 10936, 353, 8829, 10928, 351, 349, 10934, 10938, 8937, 10771, 8831, 1089, 8901, 8865, 10854, 8664, 10533, 8600, 8600, 167, 59, 10537, 8726, 8726, 10038, 120112, 8994, 9839, 1097, 1096, 8739, 8741, 173, 963, 962, 962, 8764, 10858, 8771, 8771, 10910, 10912, 10909, 10911, 8774, 10788, 10610, 8592, 8726, 10803, 10724, 8739, 8995, 10922, 10924, 1092, 5024, 1100, 47, 10692, 9023, 120164, 9824, 9824, 8741, 8851, 885, 5024, 8852, 885, 5024, 8847, 8849, 8847, 8849, 8848, 8850, 8848, 8850, 9633, 9633, 9642, 9642, 8594, 120008, 8726, 8995, 8902, 9734, 9733, 1013, 981, 175, 8834, 10949, 10941, 8838, 10947, 10945, 10955, 8842, 10943, 10617, 8834, 8838, 10949, 8842, 10955, 10951, 10965, 10963, 8827, 10936, 8829, 10928, 10938, 10934, 8937, 8831, 8721, 9834, 8835, 185, 178, 179, 10950, 10942, 10968, 8839, 10948, 10185, 10967, 10619, 10946, 10956, 8843, 10944, 8835, 8839, 10950, 8843, 10956, 10952, 10964, 10966, 8665, 10534, 8601, 8601, 10538, 223, 8982, 964, 9140, 357, 355, 1090, 8411, 8981, 120113, 8756, 8756, 952, 977, 977, 8776, 8764, 8201, 8776, 8764, 254, 732, 215, 8864, 10801, 10800, 8749, 10536, 8868, 9014, 10993, 120165, 10970, 10537, 8244, 8482, 9653, 9663, 9667, 8884, 8796, 9657, 8885, 9708, 8796, 10810, 10809, 10701, 10811, 9186, 120009, 1094, 1115, 359, 8812, 8606, 8608, 8657, 10595, 250, 8593, 1118, 365, 251, 1091, 8645, 369, 10606, 10622, 120114, 249, 8639, 8638, 9600, 8988, 8988, 8975, 9720, 363, 168, 371, 120166, 8593, 8597, 8639, 8638, 8846, 965, 978, 965, 8648, 8989, 8989, 8974, 367, 9721, 120010, 8944, 361, 9653, 9652, 8648, 252, 10663, 8661, 10984, 10985, 8872, 10652, 1013, 1008, 8709, 981, 982, 8733, 8597, 1009, 962, 884, 5024, 1095, 5024, 884, 5024, 1095, 5024, 977, 8882, 8883, 1074, 8866, 8744, 8891, 8794, 8942, 124, 124, 120115, 8882, 883, 402, 883, 402, 120167, 8733, 8883, 120011, 1095, 5024, 884, 5024, 1095, 5024, 884, 5024, 10650, 373, 10847, 8743, 8793, 8472, 120116, 120168, 8472, 8768, 8768, 120012, 8898, 9711, 8899, 9661, 120117, 10234, 10231, 958, 10232, 10229, 10236, 8955, 10752, 120169, 10753, 10754, 10233, 10230, 120013, 10758, 10756, 9651, 8897, 8896, 253, 1103, 375, 1099, 165, 120118, 1111, 120170, 120014, 1102, 255, 378, 382, 1079, 380, 8488, 950, 120119, 1078, 8669, 120171, 120015, 8205, 8204} +var _html5entitiesCodePointsIndex = "\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x02\x02\x01\x02\x01\x02\x02\x01\x02\x01\x01\x01\x01\x02\x02\x01\x02\x02\x01\x02\x01\x01\x01\x02\x01\x02\x01\x02\x01\x02\x01\x01\x02\x01\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x02\x01\x01\x02\x02\x02\x01\x01\x01\x01\x01\x02\x01\x02\x02\x01\x01\x01\x01\x01\x01\x02\x02\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x02\x01\x01\x01\x02\x01\x01\x02\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x02\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x01\x01\x01\x02\x01\x02\x01\x01\x02\x02\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x02\x01\x02\x01\x02\x01\x02\x01\x02\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x02\x02\x01\x01\x02\x02\x02\x01\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x01\x01\x01\x01\x02\x02\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01" +var _html5entitiesCharacters = [...]byte{0xc3, 0x86, 0x26, 0xc3, 0x81, 0xc3, 0x82, 0xd0, 0x90, 0xf0, 0x9d, 0x94, 0x84, 0xc3, 0x80, 0xce, 0x91, 0xc4, 0x80, 0xe2, 0xa9, 0x93, 0xc4, 0x84, 0xf0, 0x9d, 0x94, 0xb8, 0xe2, 0x81, 0xa1, 0xc3, 0x85, 0xf0, 0x9d, 0x92, 0x9c, 0xe2, 0x89, 0x94, 0xc3, 0x83, 0xc3, 0x84, 0xe2, 0x88, 0x96, 0xe2, 0xab, 0xa7, 0xe2, 0x8c, 0x86, 0xd0, 0x91, 0xe2, 0x88, 0xb5, 0xe2, 0x84, 0xac, 0xce, 0x92, 0xf0, 0x9d, 0x94, 0x85, 0xf0, 0x9d, 0x94, 0xb9, 0xcb, 0x98, 0xe2, 0x84, 0xac, 0xe2, 0x89, 0x8e, 0xd0, 0xa7, 0xc2, 0xa9, 0xc4, 0x86, 0xe2, 0x8b, 0x92, 0xe2, 0x85, 0x85, 0xe2, 0x84, 0xad, 0xc4, 0x8c, 0xc3, 0x87, 0xc4, 0x88, 0xe2, 0x88, 0xb0, 0xc4, 0x8a, 0xc2, 0xb8, 0xc2, 0xb7, 0xe2, 0x84, 0xad, 0xce, 0xa7, 0xe2, 0x8a, 0x99, 0xe2, 0x8a, 0x96, 0xe2, 0x8a, 0x95, 0xe2, 0x8a, 0x97, 0xe2, 0x88, 0xb2, 0xe2, 0x80, 0x9d, 0xe2, 0x80, 0x99, 0xe2, 0x88, 0xb7, 0xe2, 0xa9, 0xb4, 0xe2, 0x89, 0xa1, 0xe2, 0x88, 0xaf, 0xe2, 0x88, 0xae, 0xe2, 0x84, 0x82, 0xe2, 0x88, 0x90, 0xe2, 0x88, 0xb3, 0xe2, 0xa8, 0xaf, 0xf0, 0x9d, 0x92, 0x9e, 0xe2, 0x8b, 0x93, 0xe2, 0x89, 0x8d, 0xe2, 0x85, 0x85, 0xe2, 0xa4, 0x91, 0xd0, 0x82, 0xd0, 0x85, 0xd0, 0x8f, 0xe2, 0x80, 0xa1, 0xe2, 0x86, 0xa1, 0xe2, 0xab, 0xa4, 0xc4, 0x8e, 0xd0, 0x94, 0xe2, 0x88, 0x87, 0xce, 0x94, 0xf0, 0x9d, 0x94, 0x87, 0xc2, 0xb4, 0xcb, 0x99, 0xcb, 0x9d, 0x60, 0xcb, 0x9c, 0xe2, 0x8b, 0x84, 0xe2, 0x85, 0x86, 0xf0, 0x9d, 0x94, 0xbb, 0xc2, 0xa8, 0xe2, 0x83, 0x9c, 0xe2, 0x89, 0x90, 0xe2, 0x88, 0xaf, 0xc2, 0xa8, 0xe2, 0x87, 0x93, 0xe2, 0x87, 0x90, 0xe2, 0x87, 0x94, 0xe2, 0xab, 0xa4, 0xe2, 0x9f, 0xb8, 0xe2, 0x9f, 0xba, 0xe2, 0x9f, 0xb9, 0xe2, 0x87, 0x92, 0xe2, 0x8a, 0xa8, 0xe2, 0x87, 0x91, 0xe2, 0x87, 0x95, 0xe2, 0x88, 0xa5, 0xe2, 0x86, 0x93, 0xe2, 0xa4, 0x93, 0xe2, 0x87, 0xb5, 0xcc, 0x91, 0xe2, 0xa5, 0x90, 0xe2, 0xa5, 0x9e, 0xe2, 0x86, 0xbd, 0xe2, 0xa5, 0x96, 0xe2, 0xa5, 0x9f, 0xe2, 0x87, 0x81, 0xe2, 0xa5, 0x97, 0xe2, 0x8a, 0xa4, 0xe2, 0x86, 0xa7, 0xe2, 0x87, 0x93, 0xf0, 0x9d, 0x92, 0x9f, 0xc4, 0x90, 0xc5, 0x8a, 0xc3, 0x90, 0xc3, 0x89, 0xc4, 0x9a, 0xc3, 0x8a, 0xd0, 0xad, 0xc4, 0x96, 0xf0, 0x9d, 0x94, 0x88, 0xc3, 0x88, 0xe2, 0x88, 0x88, 0xc4, 0x92, 0xe2, 0x97, 0xbb, 0xe2, 0x96, 0xab, 0xc4, 0x98, 0xf0, 0x9d, 0x94, 0xbc, 0xce, 0x95, 0xe2, 0xa9, 0xb5, 0xe2, 0x89, 0x82, 0xe2, 0x87, 0x8c, 0xe2, 0x84, 0xb0, 0xe2, 0xa9, 0xb3, 0xce, 0x97, 0xc3, 0x8b, 0xe2, 0x88, 0x83, 0xe2, 0x85, 0x87, 0xd0, 0xa4, 0xf0, 0x9d, 0x94, 0x89, 0xe2, 0x97, 0xbc, 0xe2, 0x96, 0xaa, 0xf0, 0x9d, 0x94, 0xbd, 0xe2, 0x88, 0x80, 0xe2, 0x84, 0xb1, 0xe2, 0x84, 0xb1, 0xd0, 0x83, 0x3e, 0xce, 0x93, 0xcf, 0x9c, 0xc4, 0x9e, 0xc4, 0xa2, 0xc4, 0x9c, 0xd0, 0x93, 0xc4, 0xa0, 0xf0, 0x9d, 0x94, 0x8a, 0xe2, 0x8b, 0x99, 0xf0, 0x9d, 0x94, 0xbe, 0xe2, 0x89, 0xa5, 0xe2, 0x8b, 0x9b, 0xe2, 0x89, 0xa7, 0xe2, 0xaa, 0xa2, 0xe2, 0x89, 0xb7, 0xe2, 0xa9, 0xbe, 0xe2, 0x89, 0xb3, 0xf0, 0x9d, 0x92, 0xa2, 0xe2, 0x89, 0xab, 0xd0, 0xaa, 0xcb, 0x87, 0x5e, 0xc4, 0xa4, 0xe2, 0x84, 0x8c, 0xe2, 0x84, 0x8b, 0xe2, 0x84, 0x8d, 0xe2, 0x94, 0x80, 0xe2, 0x84, 0x8b, 0xc4, 0xa6, 0xe2, 0x89, 0x8e, 0xe2, 0x89, 0x8f, 0xd0, 0x95, 0xc4, 0xb2, 0xd0, 0x81, 0xc3, 0x8d, 0xc3, 0x8e, 0xd0, 0x98, 0xc4, 0xb0, 0xe2, 0x84, 0x91, 0xc3, 0x8c, 0xe2, 0x84, 0x91, 0xc4, 0xaa, 0xe2, 0x85, 0x88, 0xe2, 0x87, 0x92, 0xe2, 0x88, 0xac, 0xe2, 0x88, 0xab, 0xe2, 0x8b, 0x82, 0xe2, 0x81, 0xa3, 0xe2, 0x81, 0xa2, 0xc4, 0xae, 0xf0, 0x9d, 0x95, 0x80, 0xce, 0x99, 0xe2, 0x84, 0x90, 0xc4, 0xa8, 0xd0, 0x86, 0xc3, 0x8f, 0xc4, 0xb4, 0xd0, 0x99, 0xf0, 0x9d, 0x94, 0x8d, 0xf0, 0x9d, 0x95, 0x81, 0xf0, 0x9d, 0x92, 0xa5, 0xd0, 0x88, 0xd0, 0x84, 0xd0, 0xa5, 0xd0, 0x8c, 0xce, 0x9a, 0xc4, 0xb6, 0xd0, 0x9a, 0xf0, 0x9d, 0x94, 0x8e, 0xf0, 0x9d, 0x95, 0x82, 0xf0, 0x9d, 0x92, 0xa6, 0xd0, 0x89, 0x3c, 0xc4, 0xb9, 0xce, 0x9b, 0xe2, 0x9f, 0xaa, 0xe2, 0x84, 0x92, 0xe2, 0x86, 0x9e, 0xc4, 0xbd, 0xc4, 0xbb, 0xd0, 0x9b, 0xe2, 0x9f, 0xa8, 0xe2, 0x86, 0x90, 0xe2, 0x87, 0xa4, 0xe2, 0x87, 0x86, 0xe2, 0x8c, 0x88, 0xe2, 0x9f, 0xa6, 0xe2, 0xa5, 0xa1, 0xe2, 0x87, 0x83, 0xe2, 0xa5, 0x99, 0xe2, 0x8c, 0x8a, 0xe2, 0x86, 0x94, 0xe2, 0xa5, 0x8e, 0xe2, 0x8a, 0xa3, 0xe2, 0x86, 0xa4, 0xe2, 0xa5, 0x9a, 0xe2, 0x8a, 0xb2, 0xe2, 0xa7, 0x8f, 0xe2, 0x8a, 0xb4, 0xe2, 0xa5, 0x91, 0xe2, 0xa5, 0xa0, 0xe2, 0x86, 0xbf, 0xe2, 0xa5, 0x98, 0xe2, 0x86, 0xbc, 0xe2, 0xa5, 0x92, 0xe2, 0x87, 0x90, 0xe2, 0x87, 0x94, 0xe2, 0x8b, 0x9a, 0xe2, 0x89, 0xa6, 0xe2, 0x89, 0xb6, 0xe2, 0xaa, 0xa1, 0xe2, 0xa9, 0xbd, 0xe2, 0x89, 0xb2, 0xf0, 0x9d, 0x94, 0x8f, 0xe2, 0x8b, 0x98, 0xe2, 0x87, 0x9a, 0xc4, 0xbf, 0xe2, 0x9f, 0xb5, 0xe2, 0x9f, 0xb7, 0xe2, 0x9f, 0xb6, 0xe2, 0x9f, 0xb8, 0xe2, 0x9f, 0xba, 0xe2, 0x9f, 0xb9, 0xf0, 0x9d, 0x95, 0x83, 0xe2, 0x86, 0x99, 0xe2, 0x86, 0x98, 0xe2, 0x84, 0x92, 0xe2, 0x86, 0xb0, 0xc5, 0x81, 0xe2, 0x89, 0xaa, 0xe2, 0xa4, 0x85, 0xd0, 0x9c, 0xe2, 0x81, 0x9f, 0xe2, 0x84, 0xb3, 0xf0, 0x9d, 0x94, 0x90, 0xe2, 0x88, 0x93, 0xf0, 0x9d, 0x95, 0x84, 0xe2, 0x84, 0xb3, 0xce, 0x9c, 0xd0, 0x8a, 0xc5, 0x83, 0xc5, 0x87, 0xc5, 0x85, 0xd0, 0x9d, 0xe2, 0x80, 0x8b, 0xe2, 0x80, 0x8b, 0xe2, 0x80, 0x8b, 0xe2, 0x80, 0x8b, 0xe2, 0x89, 0xab, 0xe2, 0x89, 0xaa, 0xa, 0xf0, 0x9d, 0x94, 0x91, 0xe2, 0x81, 0xa0, 0xc2, 0xa0, 0xe2, 0x84, 0x95, 0xe2, 0xab, 0xac, 0xe2, 0x89, 0xa2, 0xe2, 0x89, 0xad, 0xe2, 0x88, 0xa6, 0xe2, 0x88, 0x89, 0xe2, 0x89, 0xa0, 0xe2, 0x89, 0x82, 0xcc, 0xb8, 0xe2, 0x88, 0x84, 0xe2, 0x89, 0xaf, 0xe2, 0x89, 0xb1, 0xe2, 0x89, 0xa7, 0xcc, 0xb8, 0xe2, 0x89, 0xab, 0xcc, 0xb8, 0xe2, 0x89, 0xb9, 0xe2, 0xa9, 0xbe, 0xcc, 0xb8, 0xe2, 0x89, 0xb5, 0xe2, 0x89, 0x8e, 0xcc, 0xb8, 0xe2, 0x89, 0x8f, 0xcc, 0xb8, 0xe2, 0x8b, 0xaa, 0xe2, 0xa7, 0x8f, 0xcc, 0xb8, 0xe2, 0x8b, 0xac, 0xe2, 0x89, 0xae, 0xe2, 0x89, 0xb0, 0xe2, 0x89, 0xb8, 0xe2, 0x89, 0xaa, 0xcc, 0xb8, 0xe2, 0xa9, 0xbd, 0xcc, 0xb8, 0xe2, 0x89, 0xb4, 0xe2, 0xaa, 0xa2, 0xcc, 0xb8, 0xe2, 0xaa, 0xa1, 0xcc, 0xb8, 0xe2, 0x8a, 0x80, 0xe2, 0xaa, 0xaf, 0xcc, 0xb8, 0xe2, 0x8b, 0xa0, 0xe2, 0x88, 0x8c, 0xe2, 0x8b, 0xab, 0xe2, 0xa7, 0x90, 0xcc, 0xb8, 0xe2, 0x8b, 0xad, 0xe2, 0x8a, 0x8f, 0xcc, 0xb8, 0xe2, 0x8b, 0xa2, 0xe2, 0x8a, 0x90, 0xcc, 0xb8, 0xe2, 0x8b, 0xa3, 0xe2, 0x8a, 0x82, 0xe2, 0x83, 0x92, 0xe2, 0x8a, 0x88, 0xe2, 0x8a, 0x81, 0xe2, 0xaa, 0xb0, 0xcc, 0xb8, 0xe2, 0x8b, 0xa1, 0xe2, 0x89, 0xbf, 0xcc, 0xb8, 0xe2, 0x8a, 0x83, 0xe2, 0x83, 0x92, 0xe2, 0x8a, 0x89, 0xe2, 0x89, 0x81, 0xe2, 0x89, 0x84, 0xe2, 0x89, 0x87, 0xe2, 0x89, 0x89, 0xe2, 0x88, 0xa4, 0xf0, 0x9d, 0x92, 0xa9, 0xc3, 0x91, 0xce, 0x9d, 0xc5, 0x92, 0xc3, 0x93, 0xc3, 0x94, 0xd0, 0x9e, 0xc5, 0x90, 0xf0, 0x9d, 0x94, 0x92, 0xc3, 0x92, 0xc5, 0x8c, 0xce, 0xa9, 0xce, 0x9f, 0xf0, 0x9d, 0x95, 0x86, 0xe2, 0x80, 0x9c, 0xe2, 0x80, 0x98, 0xe2, 0xa9, 0x94, 0xf0, 0x9d, 0x92, 0xaa, 0xc3, 0x98, 0xc3, 0x95, 0xe2, 0xa8, 0xb7, 0xc3, 0x96, 0xe2, 0x80, 0xbe, 0xe2, 0x8f, 0x9e, 0xe2, 0x8e, 0xb4, 0xe2, 0x8f, 0x9c, 0xe2, 0x88, 0x82, 0xd0, 0x9f, 0xf0, 0x9d, 0x94, 0x93, 0xce, 0xa6, 0xce, 0xa0, 0xc2, 0xb1, 0xe2, 0x84, 0x8c, 0xe2, 0x84, 0x99, 0xe2, 0xaa, 0xbb, 0xe2, 0x89, 0xba, 0xe2, 0xaa, 0xaf, 0xe2, 0x89, 0xbc, 0xe2, 0x89, 0xbe, 0xe2, 0x80, 0xb3, 0xe2, 0x88, 0x8f, 0xe2, 0x88, 0xb7, 0xe2, 0x88, 0x9d, 0xf0, 0x9d, 0x92, 0xab, 0xce, 0xa8, 0x22, 0xf0, 0x9d, 0x94, 0x94, 0xe2, 0x84, 0x9a, 0xf0, 0x9d, 0x92, 0xac, 0xe2, 0xa4, 0x90, 0xc2, 0xae, 0xc5, 0x94, 0xe2, 0x9f, 0xab, 0xe2, 0x86, 0xa0, 0xe2, 0xa4, 0x96, 0xc5, 0x98, 0xc5, 0x96, 0xd0, 0xa0, 0xe2, 0x84, 0x9c, 0xe2, 0x88, 0x8b, 0xe2, 0x87, 0x8b, 0xe2, 0xa5, 0xaf, 0xe2, 0x84, 0x9c, 0xce, 0xa1, 0xe2, 0x9f, 0xa9, 0xe2, 0x86, 0x92, 0xe2, 0x87, 0xa5, 0xe2, 0x87, 0x84, 0xe2, 0x8c, 0x89, 0xe2, 0x9f, 0xa7, 0xe2, 0xa5, 0x9d, 0xe2, 0x87, 0x82, 0xe2, 0xa5, 0x95, 0xe2, 0x8c, 0x8b, 0xe2, 0x8a, 0xa2, 0xe2, 0x86, 0xa6, 0xe2, 0xa5, 0x9b, 0xe2, 0x8a, 0xb3, 0xe2, 0xa7, 0x90, 0xe2, 0x8a, 0xb5, 0xe2, 0xa5, 0x8f, 0xe2, 0xa5, 0x9c, 0xe2, 0x86, 0xbe, 0xe2, 0xa5, 0x94, 0xe2, 0x87, 0x80, 0xe2, 0xa5, 0x93, 0xe2, 0x87, 0x92, 0xe2, 0x84, 0x9d, 0xe2, 0xa5, 0xb0, 0xe2, 0x87, 0x9b, 0xe2, 0x84, 0x9b, 0xe2, 0x86, 0xb1, 0xe2, 0xa7, 0xb4, 0xd0, 0xa9, 0xd0, 0xa8, 0xd0, 0xac, 0xc5, 0x9a, 0xe2, 0xaa, 0xbc, 0xc5, 0xa0, 0xc5, 0x9e, 0xc5, 0x9c, 0xd0, 0xa1, 0xf0, 0x9d, 0x94, 0x96, 0xe2, 0x86, 0x93, 0xe2, 0x86, 0x90, 0xe2, 0x86, 0x92, 0xe2, 0x86, 0x91, 0xce, 0xa3, 0xe2, 0x88, 0x98, 0xf0, 0x9d, 0x95, 0x8a, 0xe2, 0x88, 0x9a, 0xe2, 0x96, 0xa1, 0xe2, 0x8a, 0x93, 0xe2, 0x8a, 0x8f, 0xe2, 0x8a, 0x91, 0xe2, 0x8a, 0x90, 0xe2, 0x8a, 0x92, 0xe2, 0x8a, 0x94, 0xf0, 0x9d, 0x92, 0xae, 0xe2, 0x8b, 0x86, 0xe2, 0x8b, 0x90, 0xe2, 0x8b, 0x90, 0xe2, 0x8a, 0x86, 0xe2, 0x89, 0xbb, 0xe2, 0xaa, 0xb0, 0xe2, 0x89, 0xbd, 0xe2, 0x89, 0xbf, 0xe2, 0x88, 0x8b, 0xe2, 0x88, 0x91, 0xe2, 0x8b, 0x91, 0xe2, 0x8a, 0x83, 0xe2, 0x8a, 0x87, 0xe2, 0x8b, 0x91, 0xc3, 0x9e, 0xe2, 0x84, 0xa2, 0xd0, 0x8b, 0xd0, 0xa6, 0x9, 0xce, 0xa4, 0xc5, 0xa4, 0xc5, 0xa2, 0xd0, 0xa2, 0xf0, 0x9d, 0x94, 0x97, 0xe2, 0x88, 0xb4, 0xce, 0x98, 0xe2, 0x81, 0x9f, 0xe2, 0x80, 0x8a, 0xe2, 0x80, 0x89, 0xe2, 0x88, 0xbc, 0xe2, 0x89, 0x83, 0xe2, 0x89, 0x85, 0xe2, 0x89, 0x88, 0xf0, 0x9d, 0x95, 0x8b, 0xe2, 0x83, 0x9b, 0xf0, 0x9d, 0x92, 0xaf, 0xc5, 0xa6, 0xc3, 0x9a, 0xe2, 0x86, 0x9f, 0xe2, 0xa5, 0x89, 0xd0, 0x8e, 0xc5, 0xac, 0xc3, 0x9b, 0xd0, 0xa3, 0xc5, 0xb0, 0xf0, 0x9d, 0x94, 0x98, 0xc3, 0x99, 0xc5, 0xaa, 0x5f, 0xe2, 0x8f, 0x9f, 0xe2, 0x8e, 0xb5, 0xe2, 0x8f, 0x9d, 0xe2, 0x8b, 0x83, 0xe2, 0x8a, 0x8e, 0xc5, 0xb2, 0xf0, 0x9d, 0x95, 0x8c, 0xe2, 0x86, 0x91, 0xe2, 0xa4, 0x92, 0xe2, 0x87, 0x85, 0xe2, 0x86, 0x95, 0xe2, 0xa5, 0xae, 0xe2, 0x8a, 0xa5, 0xe2, 0x86, 0xa5, 0xe2, 0x87, 0x91, 0xe2, 0x87, 0x95, 0xe2, 0x86, 0x96, 0xe2, 0x86, 0x97, 0xcf, 0x92, 0xce, 0xa5, 0xc5, 0xae, 0xf0, 0x9d, 0x92, 0xb0, 0xc5, 0xa8, 0xc3, 0x9c, 0xe2, 0x8a, 0xab, 0xe2, 0xab, 0xab, 0xd0, 0x92, 0xe2, 0x8a, 0xa9, 0xe2, 0xab, 0xa6, 0xe2, 0x8b, 0x81, 0xe2, 0x80, 0x96, 0xe2, 0x80, 0x96, 0xe2, 0x88, 0xa3, 0x7c, 0xe2, 0x9d, 0x98, 0xe2, 0x89, 0x80, 0xe2, 0x80, 0x8a, 0xf0, 0x9d, 0x94, 0x99, 0xf0, 0x9d, 0x95, 0x8d, 0xf0, 0x9d, 0x92, 0xb1, 0xe2, 0x8a, 0xaa, 0xc5, 0xb4, 0xe2, 0x8b, 0x80, 0xf0, 0x9d, 0x94, 0x9a, 0xf0, 0x9d, 0x95, 0x8e, 0xf0, 0x9d, 0x92, 0xb2, 0xf0, 0x9d, 0x94, 0x9b, 0xce, 0x9e, 0xf0, 0x9d, 0x95, 0x8f, 0xf0, 0x9d, 0x92, 0xb3, 0xd0, 0xaf, 0xd0, 0x87, 0xd0, 0xae, 0xc3, 0x9d, 0xc5, 0xb6, 0xd0, 0xab, 0xf0, 0x9d, 0x94, 0x9c, 0xf0, 0x9d, 0x95, 0x90, 0xf0, 0x9d, 0x92, 0xb4, 0xc5, 0xb8, 0xd0, 0x96, 0xc5, 0xb9, 0xc5, 0xbd, 0xd0, 0x97, 0xc5, 0xbb, 0xe2, 0x80, 0x8b, 0xce, 0x96, 0xe2, 0x84, 0xa8, 0xe2, 0x84, 0xa4, 0xf0, 0x9d, 0x92, 0xb5, 0xc3, 0xa1, 0xc4, 0x83, 0xe2, 0x88, 0xbe, 0xe2, 0x88, 0xbe, 0xcc, 0xb3, 0xe2, 0x88, 0xbf, 0xc3, 0xa2, 0xc2, 0xb4, 0xd0, 0xb0, 0xc3, 0xa6, 0xe2, 0x81, 0xa1, 0xf0, 0x9d, 0x94, 0x9e, 0xc3, 0xa0, 0xe2, 0x84, 0xb5, 0xe2, 0x84, 0xb5, 0xce, 0xb1, 0xc4, 0x81, 0xe2, 0xa8, 0xbf, 0x26, 0xe2, 0x88, 0xa7, 0xe2, 0xa9, 0x95, 0xe2, 0xa9, 0x9c, 0xe2, 0xa9, 0x98, 0xe2, 0xa9, 0x9a, 0xe2, 0x88, 0xa0, 0xe2, 0xa6, 0xa4, 0xe2, 0x88, 0xa0, 0xe2, 0x88, 0xa1, 0xe2, 0xa6, 0xa8, 0xe2, 0xa6, 0xa9, 0xe2, 0xa6, 0xaa, 0xe2, 0xa6, 0xab, 0xe2, 0xa6, 0xac, 0xe2, 0xa6, 0xad, 0xe2, 0xa6, 0xae, 0xe2, 0xa6, 0xaf, 0xe2, 0x88, 0x9f, 0xe2, 0x8a, 0xbe, 0xe2, 0xa6, 0x9d, 0xe2, 0x88, 0xa2, 0xc3, 0x85, 0xe2, 0x8d, 0xbc, 0xc4, 0x85, 0xf0, 0x9d, 0x95, 0x92, 0xe2, 0x89, 0x88, 0xe2, 0xa9, 0xb0, 0xe2, 0xa9, 0xaf, 0xe2, 0x89, 0x8a, 0xe2, 0x89, 0x8b, 0x27, 0xe2, 0x89, 0x88, 0xe2, 0x89, 0x8a, 0xc3, 0xa5, 0xf0, 0x9d, 0x92, 0xb6, 0x2a, 0xe2, 0x89, 0x88, 0xe2, 0x89, 0x8d, 0xc3, 0xa3, 0xc3, 0xa4, 0xe2, 0x88, 0xb3, 0xe2, 0xa8, 0x91, 0xe2, 0xab, 0xad, 0xe2, 0x89, 0x8c, 0xcf, 0xb6, 0xe2, 0x80, 0xb5, 0xe2, 0x88, 0xbd, 0xe2, 0x8b, 0x8d, 0xe2, 0x8a, 0xbd, 0xe2, 0x8c, 0x85, 0xe2, 0x8c, 0x85, 0xe2, 0x8e, 0xb5, 0xe2, 0x8e, 0xb6, 0xe2, 0x89, 0x8c, 0xd0, 0xb1, 0xe2, 0x80, 0x9e, 0xe2, 0x88, 0xb5, 0xe2, 0x88, 0xb5, 0xe2, 0xa6, 0xb0, 0xcf, 0xb6, 0xe2, 0x84, 0xac, 0xce, 0xb2, 0xe2, 0x84, 0xb6, 0xe2, 0x89, 0xac, 0xf0, 0x9d, 0x94, 0x9f, 0xe2, 0x8b, 0x82, 0xe2, 0x97, 0xaf, 0xe2, 0x8b, 0x83, 0xe2, 0xa8, 0x80, 0xe2, 0xa8, 0x81, 0xe2, 0xa8, 0x82, 0xe2, 0xa8, 0x86, 0xe2, 0x98, 0x85, 0xe2, 0x96, 0xbd, 0xe2, 0x96, 0xb3, 0xe2, 0xa8, 0x84, 0xe2, 0x8b, 0x81, 0xe2, 0x8b, 0x80, 0xe2, 0xa4, 0x8d, 0xe2, 0xa7, 0xab, 0xe2, 0x96, 0xaa, 0xe2, 0x96, 0xb4, 0xe2, 0x96, 0xbe, 0xe2, 0x97, 0x82, 0xe2, 0x96, 0xb8, 0xe2, 0x90, 0xa3, 0xe2, 0x96, 0x92, 0xe2, 0x96, 0x91, 0xe2, 0x96, 0x93, 0xe2, 0x96, 0x88, 0x3d, 0xe2, 0x83, 0xa5, 0xe2, 0x89, 0xa1, 0xe2, 0x83, 0xa5, 0xe2, 0x8c, 0x90, 0xf0, 0x9d, 0x95, 0x93, 0xe2, 0x8a, 0xa5, 0xe2, 0x8a, 0xa5, 0xe2, 0x8b, 0x88, 0xe2, 0x95, 0x97, 0xe2, 0x95, 0x94, 0xe2, 0x95, 0x96, 0xe2, 0x95, 0x93, 0xe2, 0x95, 0x90, 0xe2, 0x95, 0xa6, 0xe2, 0x95, 0xa9, 0xe2, 0x95, 0xa4, 0xe2, 0x95, 0xa7, 0xe2, 0x95, 0x9d, 0xe2, 0x95, 0x9a, 0xe2, 0x95, 0x9c, 0xe2, 0x95, 0x99, 0xe2, 0x95, 0x91, 0xe2, 0x95, 0xac, 0xe2, 0x95, 0xa3, 0xe2, 0x95, 0xa0, 0xe2, 0x95, 0xab, 0xe2, 0x95, 0xa2, 0xe2, 0x95, 0x9f, 0xe2, 0xa7, 0x89, 0xe2, 0x95, 0x95, 0xe2, 0x95, 0x92, 0xe2, 0x94, 0x90, 0xe2, 0x94, 0x8c, 0xe2, 0x94, 0x80, 0xe2, 0x95, 0xa5, 0xe2, 0x95, 0xa8, 0xe2, 0x94, 0xac, 0xe2, 0x94, 0xb4, 0xe2, 0x8a, 0x9f, 0xe2, 0x8a, 0x9e, 0xe2, 0x8a, 0xa0, 0xe2, 0x95, 0x9b, 0xe2, 0x95, 0x98, 0xe2, 0x94, 0x98, 0xe2, 0x94, 0x94, 0xe2, 0x94, 0x82, 0xe2, 0x95, 0xaa, 0xe2, 0x95, 0xa1, 0xe2, 0x95, 0x9e, 0xe2, 0x94, 0xbc, 0xe2, 0x94, 0xa4, 0xe2, 0x94, 0x9c, 0xe2, 0x80, 0xb5, 0xcb, 0x98, 0xc2, 0xa6, 0xf0, 0x9d, 0x92, 0xb7, 0xe2, 0x81, 0x8f, 0xe2, 0x88, 0xbd, 0xe2, 0x8b, 0x8d, 0x5c, 0xe2, 0xa7, 0x85, 0xe2, 0x9f, 0x88, 0xe2, 0x80, 0xa2, 0xe2, 0x80, 0xa2, 0xe2, 0x89, 0x8e, 0xe2, 0xaa, 0xae, 0xe2, 0x89, 0x8f, 0xe2, 0x89, 0x8f, 0xc4, 0x87, 0xe2, 0x88, 0xa9, 0xe2, 0xa9, 0x84, 0xe2, 0xa9, 0x89, 0xe2, 0xa9, 0x8b, 0xe2, 0xa9, 0x87, 0xe2, 0xa9, 0x80, 0xe2, 0x88, 0xa9, 0xef, 0xb8, 0x80, 0xe2, 0x81, 0x81, 0xcb, 0x87, 0xe2, 0xa9, 0x8d, 0xc4, 0x8d, 0xc3, 0xa7, 0xc4, 0x89, 0xe2, 0xa9, 0x8c, 0xe2, 0xa9, 0x90, 0xc4, 0x8b, 0xc2, 0xb8, 0xe2, 0xa6, 0xb2, 0xc2, 0xa2, 0xc2, 0xb7, 0xf0, 0x9d, 0x94, 0xa0, 0xd1, 0x87, 0xe2, 0x9c, 0x93, 0xe2, 0x9c, 0x93, 0xcf, 0x87, 0xe2, 0x97, 0x8b, 0xe2, 0xa7, 0x83, 0xcb, 0x86, 0xe2, 0x89, 0x97, 0xe2, 0x86, 0xba, 0xe2, 0x86, 0xbb, 0xc2, 0xae, 0xe2, 0x93, 0x88, 0xe2, 0x8a, 0x9b, 0xe2, 0x8a, 0x9a, 0xe2, 0x8a, 0x9d, 0xe2, 0x89, 0x97, 0xe2, 0xa8, 0x90, 0xe2, 0xab, 0xaf, 0xe2, 0xa7, 0x82, 0xe2, 0x99, 0xa3, 0xe2, 0x99, 0xa3, 0x3a, 0xe2, 0x89, 0x94, 0xe2, 0x89, 0x94, 0x2c, 0x40, 0xe2, 0x88, 0x81, 0xe2, 0x88, 0x98, 0xe2, 0x88, 0x81, 0xe2, 0x84, 0x82, 0xe2, 0x89, 0x85, 0xe2, 0xa9, 0xad, 0xe2, 0x88, 0xae, 0xf0, 0x9d, 0x95, 0x94, 0xe2, 0x88, 0x90, 0xc2, 0xa9, 0xe2, 0x84, 0x97, 0xe2, 0x86, 0xb5, 0xe2, 0x9c, 0x97, 0xf0, 0x9d, 0x92, 0xb8, 0xe2, 0xab, 0x8f, 0xe2, 0xab, 0x91, 0xe2, 0xab, 0x90, 0xe2, 0xab, 0x92, 0xe2, 0x8b, 0xaf, 0xe2, 0xa4, 0xb8, 0xe2, 0xa4, 0xb5, 0xe2, 0x8b, 0x9e, 0xe2, 0x8b, 0x9f, 0xe2, 0x86, 0xb6, 0xe2, 0xa4, 0xbd, 0xe2, 0x88, 0xaa, 0xe2, 0xa9, 0x88, 0xe2, 0xa9, 0x86, 0xe2, 0xa9, 0x8a, 0xe2, 0x8a, 0x8d, 0xe2, 0xa9, 0x85, 0xe2, 0x88, 0xaa, 0xef, 0xb8, 0x80, 0xe2, 0x86, 0xb7, 0xe2, 0xa4, 0xbc, 0xe2, 0x8b, 0x9e, 0xe2, 0x8b, 0x9f, 0xe2, 0x8b, 0x8e, 0xe2, 0x8b, 0x8f, 0xc2, 0xa4, 0xe2, 0x86, 0xb6, 0xe2, 0x86, 0xb7, 0xe2, 0x8b, 0x8e, 0xe2, 0x8b, 0x8f, 0xe2, 0x88, 0xb2, 0xe2, 0x88, 0xb1, 0xe2, 0x8c, 0xad, 0xe2, 0x87, 0x93, 0xe2, 0xa5, 0xa5, 0xe2, 0x80, 0xa0, 0xe2, 0x84, 0xb8, 0xe2, 0x86, 0x93, 0xe2, 0x80, 0x90, 0xe2, 0x8a, 0xa3, 0xe2, 0xa4, 0x8f, 0xcb, 0x9d, 0xc4, 0x8f, 0xd0, 0xb4, 0xe2, 0x85, 0x86, 0xe2, 0x80, 0xa1, 0xe2, 0x87, 0x8a, 0xe2, 0xa9, 0xb7, 0xc2, 0xb0, 0xce, 0xb4, 0xe2, 0xa6, 0xb1, 0xe2, 0xa5, 0xbf, 0xf0, 0x9d, 0x94, 0xa1, 0xe2, 0x87, 0x83, 0xe2, 0x87, 0x82, 0xe2, 0x8b, 0x84, 0xe2, 0x8b, 0x84, 0xe2, 0x99, 0xa6, 0xe2, 0x99, 0xa6, 0xc2, 0xa8, 0xcf, 0x9d, 0xe2, 0x8b, 0xb2, 0xc3, 0xb7, 0xc3, 0xb7, 0xe2, 0x8b, 0x87, 0xe2, 0x8b, 0x87, 0xd1, 0x92, 0xe2, 0x8c, 0x9e, 0xe2, 0x8c, 0x8d, 0x24, 0xf0, 0x9d, 0x95, 0x95, 0xcb, 0x99, 0xe2, 0x89, 0x90, 0xe2, 0x89, 0x91, 0xe2, 0x88, 0xb8, 0xe2, 0x88, 0x94, 0xe2, 0x8a, 0xa1, 0xe2, 0x8c, 0x86, 0xe2, 0x86, 0x93, 0xe2, 0x87, 0x8a, 0xe2, 0x87, 0x83, 0xe2, 0x87, 0x82, 0xe2, 0xa4, 0x90, 0xe2, 0x8c, 0x9f, 0xe2, 0x8c, 0x8c, 0xf0, 0x9d, 0x92, 0xb9, 0xd1, 0x95, 0xe2, 0xa7, 0xb6, 0xc4, 0x91, 0xe2, 0x8b, 0xb1, 0xe2, 0x96, 0xbf, 0xe2, 0x96, 0xbe, 0xe2, 0x87, 0xb5, 0xe2, 0xa5, 0xaf, 0xe2, 0xa6, 0xa6, 0xd1, 0x9f, 0xe2, 0x9f, 0xbf, 0xe2, 0xa9, 0xb7, 0xe2, 0x89, 0x91, 0xc3, 0xa9, 0xe2, 0xa9, 0xae, 0xc4, 0x9b, 0xe2, 0x89, 0x96, 0xc3, 0xaa, 0xe2, 0x89, 0x95, 0xd1, 0x8d, 0xc4, 0x97, 0xe2, 0x85, 0x87, 0xe2, 0x89, 0x92, 0xf0, 0x9d, 0x94, 0xa2, 0xe2, 0xaa, 0x9a, 0xc3, 0xa8, 0xe2, 0xaa, 0x96, 0xe2, 0xaa, 0x98, 0xe2, 0xaa, 0x99, 0xe2, 0x8f, 0xa7, 0xe2, 0x84, 0x93, 0xe2, 0xaa, 0x95, 0xe2, 0xaa, 0x97, 0xc4, 0x93, 0xe2, 0x88, 0x85, 0xe2, 0x88, 0x85, 0xe2, 0x88, 0x85, 0xe2, 0x80, 0x83, 0xe2, 0x80, 0x84, 0xe2, 0x80, 0x85, 0xc5, 0x8b, 0xe2, 0x80, 0x82, 0xc4, 0x99, 0xf0, 0x9d, 0x95, 0x96, 0xe2, 0x8b, 0x95, 0xe2, 0xa7, 0xa3, 0xe2, 0xa9, 0xb1, 0xce, 0xb5, 0xce, 0xb5, 0xcf, 0xb5, 0xe2, 0x89, 0x96, 0xe2, 0x89, 0x95, 0xe2, 0x89, 0x82, 0xe2, 0xaa, 0x96, 0xe2, 0xaa, 0x95, 0x3d, 0xe2, 0x89, 0x9f, 0xe2, 0x89, 0xa1, 0xe2, 0xa9, 0xb8, 0xe2, 0xa7, 0xa5, 0xe2, 0x89, 0x93, 0xe2, 0xa5, 0xb1, 0xe2, 0x84, 0xaf, 0xe2, 0x89, 0x90, 0xe2, 0x89, 0x82, 0xce, 0xb7, 0xc3, 0xb0, 0xc3, 0xab, 0xe2, 0x82, 0xac, 0x21, 0xe2, 0x88, 0x83, 0xe2, 0x84, 0xb0, 0xe2, 0x85, 0x87, 0xe2, 0x89, 0x92, 0xd1, 0x84, 0xe2, 0x99, 0x80, 0xef, 0xac, 0x83, 0xef, 0xac, 0x80, 0xef, 0xac, 0x84, 0xf0, 0x9d, 0x94, 0xa3, 0xef, 0xac, 0x81, 0x66, 0x6a, 0xe2, 0x99, 0xad, 0xef, 0xac, 0x82, 0xe2, 0x96, 0xb1, 0xc6, 0x92, 0xf0, 0x9d, 0x95, 0x97, 0xe2, 0x88, 0x80, 0xe2, 0x8b, 0x94, 0xe2, 0xab, 0x99, 0xe2, 0xa8, 0x8d, 0xc2, 0xbd, 0xe2, 0x85, 0x93, 0xc2, 0xbc, 0xe2, 0x85, 0x95, 0xe2, 0x85, 0x99, 0xe2, 0x85, 0x9b, 0xe2, 0x85, 0x94, 0xe2, 0x85, 0x96, 0xc2, 0xbe, 0xe2, 0x85, 0x97, 0xe2, 0x85, 0x9c, 0xe2, 0x85, 0x98, 0xe2, 0x85, 0x9a, 0xe2, 0x85, 0x9d, 0xe2, 0x85, 0x9e, 0xe2, 0x81, 0x84, 0xe2, 0x8c, 0xa2, 0xf0, 0x9d, 0x92, 0xbb, 0xe2, 0x89, 0xa7, 0xe2, 0xaa, 0x8c, 0xc7, 0xb5, 0xce, 0xb3, 0xcf, 0x9d, 0xe2, 0xaa, 0x86, 0xc4, 0x9f, 0xc4, 0x9d, 0xd0, 0xb3, 0xc4, 0xa1, 0xe2, 0x89, 0xa5, 0xe2, 0x8b, 0x9b, 0xe2, 0x89, 0xa5, 0xe2, 0x89, 0xa7, 0xe2, 0xa9, 0xbe, 0xe2, 0xa9, 0xbe, 0xe2, 0xaa, 0xa9, 0xe2, 0xaa, 0x80, 0xe2, 0xaa, 0x82, 0xe2, 0xaa, 0x84, 0xe2, 0x8b, 0x9b, 0xef, 0xb8, 0x80, 0xe2, 0xaa, 0x94, 0xf0, 0x9d, 0x94, 0xa4, 0xe2, 0x89, 0xab, 0xe2, 0x8b, 0x99, 0xe2, 0x84, 0xb7, 0xd1, 0x93, 0xe2, 0x89, 0xb7, 0xe2, 0xaa, 0x92, 0xe2, 0xaa, 0xa5, 0xe2, 0xaa, 0xa4, 0xe2, 0x89, 0xa9, 0xe2, 0xaa, 0x8a, 0xe2, 0xaa, 0x8a, 0xe2, 0xaa, 0x88, 0xe2, 0xaa, 0x88, 0xe2, 0x89, 0xa9, 0xe2, 0x8b, 0xa7, 0xf0, 0x9d, 0x95, 0x98, 0x60, 0xe2, 0x84, 0x8a, 0xe2, 0x89, 0xb3, 0xe2, 0xaa, 0x8e, 0xe2, 0xaa, 0x90, 0x3e, 0xe2, 0xaa, 0xa7, 0xe2, 0xa9, 0xba, 0xe2, 0x8b, 0x97, 0xe2, 0xa6, 0x95, 0xe2, 0xa9, 0xbc, 0xe2, 0xaa, 0x86, 0xe2, 0xa5, 0xb8, 0xe2, 0x8b, 0x97, 0xe2, 0x8b, 0x9b, 0xe2, 0xaa, 0x8c, 0xe2, 0x89, 0xb7, 0xe2, 0x89, 0xb3, 0xe2, 0x89, 0xa9, 0xef, 0xb8, 0x80, 0xe2, 0x89, 0xa9, 0xef, 0xb8, 0x80, 0xe2, 0x87, 0x94, 0xe2, 0x80, 0x8a, 0xc2, 0xbd, 0xe2, 0x84, 0x8b, 0xd1, 0x8a, 0xe2, 0x86, 0x94, 0xe2, 0xa5, 0x88, 0xe2, 0x86, 0xad, 0xe2, 0x84, 0x8f, 0xc4, 0xa5, 0xe2, 0x99, 0xa5, 0xe2, 0x99, 0xa5, 0xe2, 0x80, 0xa6, 0xe2, 0x8a, 0xb9, 0xf0, 0x9d, 0x94, 0xa5, 0xe2, 0xa4, 0xa5, 0xe2, 0xa4, 0xa6, 0xe2, 0x87, 0xbf, 0xe2, 0x88, 0xbb, 0xe2, 0x86, 0xa9, 0xe2, 0x86, 0xaa, 0xf0, 0x9d, 0x95, 0x99, 0xe2, 0x80, 0x95, 0xf0, 0x9d, 0x92, 0xbd, 0xe2, 0x84, 0x8f, 0xc4, 0xa7, 0xe2, 0x81, 0x83, 0xe2, 0x80, 0x90, 0xc3, 0xad, 0xe2, 0x81, 0xa3, 0xc3, 0xae, 0xd0, 0xb8, 0xd0, 0xb5, 0xc2, 0xa1, 0xe2, 0x87, 0x94, 0xf0, 0x9d, 0x94, 0xa6, 0xc3, 0xac, 0xe2, 0x85, 0x88, 0xe2, 0xa8, 0x8c, 0xe2, 0x88, 0xad, 0xe2, 0xa7, 0x9c, 0xe2, 0x84, 0xa9, 0xc4, 0xb3, 0xc4, 0xab, 0xe2, 0x84, 0x91, 0xe2, 0x84, 0x90, 0xe2, 0x84, 0x91, 0xc4, 0xb1, 0xe2, 0x8a, 0xb7, 0xc6, 0xb5, 0xe2, 0x88, 0x88, 0xe2, 0x84, 0x85, 0xe2, 0x88, 0x9e, 0xe2, 0xa7, 0x9d, 0xc4, 0xb1, 0xe2, 0x88, 0xab, 0xe2, 0x8a, 0xba, 0xe2, 0x84, 0xa4, 0xe2, 0x8a, 0xba, 0xe2, 0xa8, 0x97, 0xe2, 0xa8, 0xbc, 0xd1, 0x91, 0xc4, 0xaf, 0xf0, 0x9d, 0x95, 0x9a, 0xce, 0xb9, 0xe2, 0xa8, 0xbc, 0xc2, 0xbf, 0xf0, 0x9d, 0x92, 0xbe, 0xe2, 0x88, 0x88, 0xe2, 0x8b, 0xb9, 0xe2, 0x8b, 0xb5, 0xe2, 0x8b, 0xb4, 0xe2, 0x8b, 0xb3, 0xe2, 0x88, 0x88, 0xe2, 0x81, 0xa2, 0xc4, 0xa9, 0xd1, 0x96, 0xc3, 0xaf, 0xc4, 0xb5, 0xd0, 0xb9, 0xf0, 0x9d, 0x94, 0xa7, 0xc8, 0xb7, 0xf0, 0x9d, 0x95, 0x9b, 0xf0, 0x9d, 0x92, 0xbf, 0xd1, 0x98, 0xd1, 0x94, 0xce, 0xba, 0xcf, 0xb0, 0xc4, 0xb7, 0xd0, 0xba, 0xf0, 0x9d, 0x94, 0xa8, 0xc4, 0xb8, 0xd1, 0x85, 0xd1, 0x9c, 0xf0, 0x9d, 0x95, 0x9c, 0xf0, 0x9d, 0x93, 0x80, 0xe2, 0x87, 0x9a, 0xe2, 0x87, 0x90, 0xe2, 0xa4, 0x9b, 0xe2, 0xa4, 0x8e, 0xe2, 0x89, 0xa6, 0xe2, 0xaa, 0x8b, 0xe2, 0xa5, 0xa2, 0xc4, 0xba, 0xe2, 0xa6, 0xb4, 0xe2, 0x84, 0x92, 0xce, 0xbb, 0xe2, 0x9f, 0xa8, 0xe2, 0xa6, 0x91, 0xe2, 0x9f, 0xa8, 0xe2, 0xaa, 0x85, 0xc2, 0xab, 0xe2, 0x86, 0x90, 0xe2, 0x87, 0xa4, 0xe2, 0xa4, 0x9f, 0xe2, 0xa4, 0x9d, 0xe2, 0x86, 0xa9, 0xe2, 0x86, 0xab, 0xe2, 0xa4, 0xb9, 0xe2, 0xa5, 0xb3, 0xe2, 0x86, 0xa2, 0xe2, 0xaa, 0xab, 0xe2, 0xa4, 0x99, 0xe2, 0xaa, 0xad, 0xe2, 0xaa, 0xad, 0xef, 0xb8, 0x80, 0xe2, 0xa4, 0x8c, 0xe2, 0x9d, 0xb2, 0x7b, 0x5b, 0xe2, 0xa6, 0x8b, 0xe2, 0xa6, 0x8f, 0xe2, 0xa6, 0x8d, 0xc4, 0xbe, 0xc4, 0xbc, 0xe2, 0x8c, 0x88, 0x7b, 0xd0, 0xbb, 0xe2, 0xa4, 0xb6, 0xe2, 0x80, 0x9c, 0xe2, 0x80, 0x9e, 0xe2, 0xa5, 0xa7, 0xe2, 0xa5, 0x8b, 0xe2, 0x86, 0xb2, 0xe2, 0x89, 0xa4, 0xe2, 0x86, 0x90, 0xe2, 0x86, 0xa2, 0xe2, 0x86, 0xbd, 0xe2, 0x86, 0xbc, 0xe2, 0x87, 0x87, 0xe2, 0x86, 0x94, 0xe2, 0x87, 0x86, 0xe2, 0x87, 0x8b, 0xe2, 0x86, 0xad, 0xe2, 0x8b, 0x8b, 0xe2, 0x8b, 0x9a, 0xe2, 0x89, 0xa4, 0xe2, 0x89, 0xa6, 0xe2, 0xa9, 0xbd, 0xe2, 0xa9, 0xbd, 0xe2, 0xaa, 0xa8, 0xe2, 0xa9, 0xbf, 0xe2, 0xaa, 0x81, 0xe2, 0xaa, 0x83, 0xe2, 0x8b, 0x9a, 0xef, 0xb8, 0x80, 0xe2, 0xaa, 0x93, 0xe2, 0xaa, 0x85, 0xe2, 0x8b, 0x96, 0xe2, 0x8b, 0x9a, 0xe2, 0xaa, 0x8b, 0xe2, 0x89, 0xb6, 0xe2, 0x89, 0xb2, 0xe2, 0xa5, 0xbc, 0xe2, 0x8c, 0x8a, 0xf0, 0x9d, 0x94, 0xa9, 0xe2, 0x89, 0xb6, 0xe2, 0xaa, 0x91, 0xe2, 0x86, 0xbd, 0xe2, 0x86, 0xbc, 0xe2, 0xa5, 0xaa, 0xe2, 0x96, 0x84, 0xd1, 0x99, 0xe2, 0x89, 0xaa, 0xe2, 0x87, 0x87, 0xe2, 0x8c, 0x9e, 0xe2, 0xa5, 0xab, 0xe2, 0x97, 0xba, 0xc5, 0x80, 0xe2, 0x8e, 0xb0, 0xe2, 0x8e, 0xb0, 0xe2, 0x89, 0xa8, 0xe2, 0xaa, 0x89, 0xe2, 0xaa, 0x89, 0xe2, 0xaa, 0x87, 0xe2, 0xaa, 0x87, 0xe2, 0x89, 0xa8, 0xe2, 0x8b, 0xa6, 0xe2, 0x9f, 0xac, 0xe2, 0x87, 0xbd, 0xe2, 0x9f, 0xa6, 0xe2, 0x9f, 0xb5, 0xe2, 0x9f, 0xb7, 0xe2, 0x9f, 0xbc, 0xe2, 0x9f, 0xb6, 0xe2, 0x86, 0xab, 0xe2, 0x86, 0xac, 0xe2, 0xa6, 0x85, 0xf0, 0x9d, 0x95, 0x9d, 0xe2, 0xa8, 0xad, 0xe2, 0xa8, 0xb4, 0xe2, 0x88, 0x97, 0x5f, 0xe2, 0x97, 0x8a, 0xe2, 0x97, 0x8a, 0xe2, 0xa7, 0xab, 0x28, 0xe2, 0xa6, 0x93, 0xe2, 0x87, 0x86, 0xe2, 0x8c, 0x9f, 0xe2, 0x87, 0x8b, 0xe2, 0xa5, 0xad, 0xe2, 0x80, 0x8e, 0xe2, 0x8a, 0xbf, 0xe2, 0x80, 0xb9, 0xf0, 0x9d, 0x93, 0x81, 0xe2, 0x86, 0xb0, 0xe2, 0x89, 0xb2, 0xe2, 0xaa, 0x8d, 0xe2, 0xaa, 0x8f, 0x5b, 0xe2, 0x80, 0x98, 0xe2, 0x80, 0x9a, 0xc5, 0x82, 0x3c, 0xe2, 0xaa, 0xa6, 0xe2, 0xa9, 0xb9, 0xe2, 0x8b, 0x96, 0xe2, 0x8b, 0x8b, 0xe2, 0x8b, 0x89, 0xe2, 0xa5, 0xb6, 0xe2, 0xa9, 0xbb, 0xe2, 0xa6, 0x96, 0xe2, 0x97, 0x83, 0xe2, 0x8a, 0xb4, 0xe2, 0x97, 0x82, 0xe2, 0xa5, 0x8a, 0xe2, 0xa5, 0xa6, 0xe2, 0x89, 0xa8, 0xef, 0xb8, 0x80, 0xe2, 0x89, 0xa8, 0xef, 0xb8, 0x80, 0xe2, 0x88, 0xba, 0xc2, 0xaf, 0xe2, 0x99, 0x82, 0xe2, 0x9c, 0xa0, 0xe2, 0x9c, 0xa0, 0xe2, 0x86, 0xa6, 0xe2, 0x86, 0xa6, 0xe2, 0x86, 0xa7, 0xe2, 0x86, 0xa4, 0xe2, 0x86, 0xa5, 0xe2, 0x96, 0xae, 0xe2, 0xa8, 0xa9, 0xd0, 0xbc, 0xe2, 0x80, 0x94, 0xe2, 0x88, 0xa1, 0xf0, 0x9d, 0x94, 0xaa, 0xe2, 0x84, 0xa7, 0xc2, 0xb5, 0xe2, 0x88, 0xa3, 0x2a, 0xe2, 0xab, 0xb0, 0xc2, 0xb7, 0xe2, 0x88, 0x92, 0xe2, 0x8a, 0x9f, 0xe2, 0x88, 0xb8, 0xe2, 0xa8, 0xaa, 0xe2, 0xab, 0x9b, 0xe2, 0x80, 0xa6, 0xe2, 0x88, 0x93, 0xe2, 0x8a, 0xa7, 0xf0, 0x9d, 0x95, 0x9e, 0xe2, 0x88, 0x93, 0xf0, 0x9d, 0x93, 0x82, 0xe2, 0x88, 0xbe, 0xce, 0xbc, 0xe2, 0x8a, 0xb8, 0xe2, 0x8a, 0xb8, 0xe2, 0x8b, 0x99, 0xcc, 0xb8, 0xe2, 0x89, 0xab, 0xe2, 0x83, 0x92, 0xe2, 0x89, 0xab, 0xcc, 0xb8, 0xe2, 0x87, 0x8d, 0xe2, 0x87, 0x8e, 0xe2, 0x8b, 0x98, 0xcc, 0xb8, 0xe2, 0x89, 0xaa, 0xe2, 0x83, 0x92, 0xe2, 0x89, 0xaa, 0xcc, 0xb8, 0xe2, 0x87, 0x8f, 0xe2, 0x8a, 0xaf, 0xe2, 0x8a, 0xae, 0xe2, 0x88, 0x87, 0xc5, 0x84, 0xe2, 0x88, 0xa0, 0xe2, 0x83, 0x92, 0xe2, 0x89, 0x89, 0xe2, 0xa9, 0xb0, 0xcc, 0xb8, 0xe2, 0x89, 0x8b, 0xcc, 0xb8, 0xc5, 0x89, 0xe2, 0x89, 0x89, 0xe2, 0x99, 0xae, 0xe2, 0x99, 0xae, 0xe2, 0x84, 0x95, 0xc2, 0xa0, 0xe2, 0x89, 0x8e, 0xcc, 0xb8, 0xe2, 0x89, 0x8f, 0xcc, 0xb8, 0xe2, 0xa9, 0x83, 0xc5, 0x88, 0xc5, 0x86, 0xe2, 0x89, 0x87, 0xe2, 0xa9, 0xad, 0xcc, 0xb8, 0xe2, 0xa9, 0x82, 0xd0, 0xbd, 0xe2, 0x80, 0x93, 0xe2, 0x89, 0xa0, 0xe2, 0x87, 0x97, 0xe2, 0xa4, 0xa4, 0xe2, 0x86, 0x97, 0xe2, 0x86, 0x97, 0xe2, 0x89, 0x90, 0xcc, 0xb8, 0xe2, 0x89, 0xa2, 0xe2, 0xa4, 0xa8, 0xe2, 0x89, 0x82, 0xcc, 0xb8, 0xe2, 0x88, 0x84, 0xe2, 0x88, 0x84, 0xf0, 0x9d, 0x94, 0xab, 0xe2, 0x89, 0xa7, 0xcc, 0xb8, 0xe2, 0x89, 0xb1, 0xe2, 0x89, 0xb1, 0xe2, 0x89, 0xa7, 0xcc, 0xb8, 0xe2, 0xa9, 0xbe, 0xcc, 0xb8, 0xe2, 0xa9, 0xbe, 0xcc, 0xb8, 0xe2, 0x89, 0xb5, 0xe2, 0x89, 0xaf, 0xe2, 0x89, 0xaf, 0xe2, 0x87, 0x8e, 0xe2, 0x86, 0xae, 0xe2, 0xab, 0xb2, 0xe2, 0x88, 0x8b, 0xe2, 0x8b, 0xbc, 0xe2, 0x8b, 0xba, 0xe2, 0x88, 0x8b, 0xd1, 0x9a, 0xe2, 0x87, 0x8d, 0xe2, 0x89, 0xa6, 0xcc, 0xb8, 0xe2, 0x86, 0x9a, 0xe2, 0x80, 0xa5, 0xe2, 0x89, 0xb0, 0xe2, 0x86, 0x9a, 0xe2, 0x86, 0xae, 0xe2, 0x89, 0xb0, 0xe2, 0x89, 0xa6, 0xcc, 0xb8, 0xe2, 0xa9, 0xbd, 0xcc, 0xb8, 0xe2, 0xa9, 0xbd, 0xcc, 0xb8, 0xe2, 0x89, 0xae, 0xe2, 0x89, 0xb4, 0xe2, 0x89, 0xae, 0xe2, 0x8b, 0xaa, 0xe2, 0x8b, 0xac, 0xe2, 0x88, 0xa4, 0xf0, 0x9d, 0x95, 0x9f, 0xc2, 0xac, 0xe2, 0x88, 0x89, 0xe2, 0x8b, 0xb9, 0xcc, 0xb8, 0xe2, 0x8b, 0xb5, 0xcc, 0xb8, 0xe2, 0x88, 0x89, 0xe2, 0x8b, 0xb7, 0xe2, 0x8b, 0xb6, 0xe2, 0x88, 0x8c, 0xe2, 0x88, 0x8c, 0xe2, 0x8b, 0xbe, 0xe2, 0x8b, 0xbd, 0xe2, 0x88, 0xa6, 0xe2, 0x88, 0xa6, 0xe2, 0xab, 0xbd, 0xe2, 0x83, 0xa5, 0xe2, 0x88, 0x82, 0xcc, 0xb8, 0xe2, 0xa8, 0x94, 0xe2, 0x8a, 0x80, 0xe2, 0x8b, 0xa0, 0xe2, 0xaa, 0xaf, 0xcc, 0xb8, 0xe2, 0x8a, 0x80, 0xe2, 0xaa, 0xaf, 0xcc, 0xb8, 0xe2, 0x87, 0x8f, 0xe2, 0x86, 0x9b, 0xe2, 0xa4, 0xb3, 0xcc, 0xb8, 0xe2, 0x86, 0x9d, 0xcc, 0xb8, 0xe2, 0x86, 0x9b, 0xe2, 0x8b, 0xab, 0xe2, 0x8b, 0xad, 0xe2, 0x8a, 0x81, 0xe2, 0x8b, 0xa1, 0xe2, 0xaa, 0xb0, 0xcc, 0xb8, 0xf0, 0x9d, 0x93, 0x83, 0xe2, 0x88, 0xa4, 0xe2, 0x88, 0xa6, 0xe2, 0x89, 0x81, 0xe2, 0x89, 0x84, 0xe2, 0x89, 0x84, 0xe2, 0x88, 0xa4, 0xe2, 0x88, 0xa6, 0xe2, 0x8b, 0xa2, 0xe2, 0x8b, 0xa3, 0xe2, 0x8a, 0x84, 0xe2, 0xab, 0x85, 0xcc, 0xb8, 0xe2, 0x8a, 0x88, 0xe2, 0x8a, 0x82, 0xe2, 0x83, 0x92, 0xe2, 0x8a, 0x88, 0xe2, 0xab, 0x85, 0xcc, 0xb8, 0xe2, 0x8a, 0x81, 0xe2, 0xaa, 0xb0, 0xcc, 0xb8, 0xe2, 0x8a, 0x85, 0xe2, 0xab, 0x86, 0xcc, 0xb8, 0xe2, 0x8a, 0x89, 0xe2, 0x8a, 0x83, 0xe2, 0x83, 0x92, 0xe2, 0x8a, 0x89, 0xe2, 0xab, 0x86, 0xcc, 0xb8, 0xe2, 0x89, 0xb9, 0xc3, 0xb1, 0xe2, 0x89, 0xb8, 0xe2, 0x8b, 0xaa, 0xe2, 0x8b, 0xac, 0xe2, 0x8b, 0xab, 0xe2, 0x8b, 0xad, 0xce, 0xbd, 0x23, 0xe2, 0x84, 0x96, 0xe2, 0x80, 0x87, 0xe2, 0x8a, 0xad, 0xe2, 0xa4, 0x84, 0xe2, 0x89, 0x8d, 0xe2, 0x83, 0x92, 0xe2, 0x8a, 0xac, 0xe2, 0x89, 0xa5, 0xe2, 0x83, 0x92, 0x3e, 0xe2, 0x83, 0x92, 0xe2, 0xa7, 0x9e, 0xe2, 0xa4, 0x82, 0xe2, 0x89, 0xa4, 0xe2, 0x83, 0x92, 0x3c, 0xe2, 0x83, 0x92, 0xe2, 0x8a, 0xb4, 0xe2, 0x83, 0x92, 0xe2, 0xa4, 0x83, 0xe2, 0x8a, 0xb5, 0xe2, 0x83, 0x92, 0xe2, 0x88, 0xbc, 0xe2, 0x83, 0x92, 0xe2, 0x87, 0x96, 0xe2, 0xa4, 0xa3, 0xe2, 0x86, 0x96, 0xe2, 0x86, 0x96, 0xe2, 0xa4, 0xa7, 0xe2, 0x93, 0x88, 0xc3, 0xb3, 0xe2, 0x8a, 0x9b, 0xe2, 0x8a, 0x9a, 0xc3, 0xb4, 0xd0, 0xbe, 0xe2, 0x8a, 0x9d, 0xc5, 0x91, 0xe2, 0xa8, 0xb8, 0xe2, 0x8a, 0x99, 0xe2, 0xa6, 0xbc, 0xc5, 0x93, 0xe2, 0xa6, 0xbf, 0xf0, 0x9d, 0x94, 0xac, 0xcb, 0x9b, 0xc3, 0xb2, 0xe2, 0xa7, 0x81, 0xe2, 0xa6, 0xb5, 0xce, 0xa9, 0xe2, 0x88, 0xae, 0xe2, 0x86, 0xba, 0xe2, 0xa6, 0xbe, 0xe2, 0xa6, 0xbb, 0xe2, 0x80, 0xbe, 0xe2, 0xa7, 0x80, 0xc5, 0x8d, 0xcf, 0x89, 0xce, 0xbf, 0xe2, 0xa6, 0xb6, 0xe2, 0x8a, 0x96, 0xf0, 0x9d, 0x95, 0xa0, 0xe2, 0xa6, 0xb7, 0xe2, 0xa6, 0xb9, 0xe2, 0x8a, 0x95, 0xe2, 0x88, 0xa8, 0xe2, 0x86, 0xbb, 0xe2, 0xa9, 0x9d, 0xe2, 0x84, 0xb4, 0xe2, 0x84, 0xb4, 0xc2, 0xaa, 0xc2, 0xba, 0xe2, 0x8a, 0xb6, 0xe2, 0xa9, 0x96, 0xe2, 0xa9, 0x97, 0xe2, 0xa9, 0x9b, 0xe2, 0x84, 0xb4, 0xc3, 0xb8, 0xe2, 0x8a, 0x98, 0xc3, 0xb5, 0xe2, 0x8a, 0x97, 0xe2, 0xa8, 0xb6, 0xc3, 0xb6, 0xe2, 0x8c, 0xbd, 0xe2, 0x88, 0xa5, 0xc2, 0xb6, 0xe2, 0x88, 0xa5, 0xe2, 0xab, 0xb3, 0xe2, 0xab, 0xbd, 0xe2, 0x88, 0x82, 0xd0, 0xbf, 0x25, 0x2e, 0xe2, 0x80, 0xb0, 0xe2, 0x8a, 0xa5, 0xe2, 0x80, 0xb1, 0xf0, 0x9d, 0x94, 0xad, 0xcf, 0x86, 0xcf, 0x95, 0xe2, 0x84, 0xb3, 0xe2, 0x98, 0x8e, 0xcf, 0x80, 0xe2, 0x8b, 0x94, 0xcf, 0x96, 0xe2, 0x84, 0x8f, 0xe2, 0x84, 0x8e, 0xe2, 0x84, 0x8f, 0x2b, 0xe2, 0xa8, 0xa3, 0xe2, 0x8a, 0x9e, 0xe2, 0xa8, 0xa2, 0xe2, 0x88, 0x94, 0xe2, 0xa8, 0xa5, 0xe2, 0xa9, 0xb2, 0xc2, 0xb1, 0xe2, 0xa8, 0xa6, 0xe2, 0xa8, 0xa7, 0xc2, 0xb1, 0xe2, 0xa8, 0x95, 0xf0, 0x9d, 0x95, 0xa1, 0xc2, 0xa3, 0xe2, 0x89, 0xba, 0xe2, 0xaa, 0xb3, 0xe2, 0xaa, 0xb7, 0xe2, 0x89, 0xbc, 0xe2, 0xaa, 0xaf, 0xe2, 0x89, 0xba, 0xe2, 0xaa, 0xb7, 0xe2, 0x89, 0xbc, 0xe2, 0xaa, 0xaf, 0xe2, 0xaa, 0xb9, 0xe2, 0xaa, 0xb5, 0xe2, 0x8b, 0xa8, 0xe2, 0x89, 0xbe, 0xe2, 0x80, 0xb2, 0xe2, 0x84, 0x99, 0xe2, 0xaa, 0xb5, 0xe2, 0xaa, 0xb9, 0xe2, 0x8b, 0xa8, 0xe2, 0x88, 0x8f, 0xe2, 0x8c, 0xae, 0xe2, 0x8c, 0x92, 0xe2, 0x8c, 0x93, 0xe2, 0x88, 0x9d, 0xe2, 0x88, 0x9d, 0xe2, 0x89, 0xbe, 0xe2, 0x8a, 0xb0, 0xf0, 0x9d, 0x93, 0x85, 0xcf, 0x88, 0xe2, 0x80, 0x88, 0xf0, 0x9d, 0x94, 0xae, 0xe2, 0xa8, 0x8c, 0xf0, 0x9d, 0x95, 0xa2, 0xe2, 0x81, 0x97, 0xf0, 0x9d, 0x93, 0x86, 0xe2, 0x84, 0x8d, 0xe2, 0xa8, 0x96, 0x3f, 0xe2, 0x89, 0x9f, 0x22, 0xe2, 0x87, 0x9b, 0xe2, 0x87, 0x92, 0xe2, 0xa4, 0x9c, 0xe2, 0xa4, 0x8f, 0xe2, 0xa5, 0xa4, 0xe2, 0x88, 0xbd, 0xcc, 0xb1, 0xc5, 0x95, 0xe2, 0x88, 0x9a, 0xe2, 0xa6, 0xb3, 0xe2, 0x9f, 0xa9, 0xe2, 0xa6, 0x92, 0xe2, 0xa6, 0xa5, 0xe2, 0x9f, 0xa9, 0xc2, 0xbb, 0xe2, 0x86, 0x92, 0xe2, 0xa5, 0xb5, 0xe2, 0x87, 0xa5, 0xe2, 0xa4, 0xa0, 0xe2, 0xa4, 0xb3, 0xe2, 0xa4, 0x9e, 0xe2, 0x86, 0xaa, 0xe2, 0x86, 0xac, 0xe2, 0xa5, 0x85, 0xe2, 0xa5, 0xb4, 0xe2, 0x86, 0xa3, 0xe2, 0x86, 0x9d, 0xe2, 0xa4, 0x9a, 0xe2, 0x88, 0xb6, 0xe2, 0x84, 0x9a, 0xe2, 0xa4, 0x8d, 0xe2, 0x9d, 0xb3, 0x7d, 0x5d, 0xe2, 0xa6, 0x8c, 0xe2, 0xa6, 0x8e, 0xe2, 0xa6, 0x90, 0xc5, 0x99, 0xc5, 0x97, 0xe2, 0x8c, 0x89, 0x7d, 0xd1, 0x80, 0xe2, 0xa4, 0xb7, 0xe2, 0xa5, 0xa9, 0xe2, 0x80, 0x9d, 0xe2, 0x80, 0x9d, 0xe2, 0x86, 0xb3, 0xe2, 0x84, 0x9c, 0xe2, 0x84, 0x9b, 0xe2, 0x84, 0x9c, 0xe2, 0x84, 0x9d, 0xe2, 0x96, 0xad, 0xc2, 0xae, 0xe2, 0xa5, 0xbd, 0xe2, 0x8c, 0x8b, 0xf0, 0x9d, 0x94, 0xaf, 0xe2, 0x87, 0x81, 0xe2, 0x87, 0x80, 0xe2, 0xa5, 0xac, 0xcf, 0x81, 0xcf, 0xb1, 0xe2, 0x86, 0x92, 0xe2, 0x86, 0xa3, 0xe2, 0x87, 0x81, 0xe2, 0x87, 0x80, 0xe2, 0x87, 0x84, 0xe2, 0x87, 0x8c, 0xe2, 0x87, 0x89, 0xe2, 0x86, 0x9d, 0xe2, 0x8b, 0x8c, 0xcb, 0x9a, 0xe2, 0x89, 0x93, 0xe2, 0x87, 0x84, 0xe2, 0x87, 0x8c, 0xe2, 0x80, 0x8f, 0xe2, 0x8e, 0xb1, 0xe2, 0x8e, 0xb1, 0xe2, 0xab, 0xae, 0xe2, 0x9f, 0xad, 0xe2, 0x87, 0xbe, 0xe2, 0x9f, 0xa7, 0xe2, 0xa6, 0x86, 0xf0, 0x9d, 0x95, 0xa3, 0xe2, 0xa8, 0xae, 0xe2, 0xa8, 0xb5, 0x29, 0xe2, 0xa6, 0x94, 0xe2, 0xa8, 0x92, 0xe2, 0x87, 0x89, 0xe2, 0x80, 0xba, 0xf0, 0x9d, 0x93, 0x87, 0xe2, 0x86, 0xb1, 0x5d, 0xe2, 0x80, 0x99, 0xe2, 0x80, 0x99, 0xe2, 0x8b, 0x8c, 0xe2, 0x8b, 0x8a, 0xe2, 0x96, 0xb9, 0xe2, 0x8a, 0xb5, 0xe2, 0x96, 0xb8, 0xe2, 0xa7, 0x8e, 0xe2, 0xa5, 0xa8, 0xe2, 0x84, 0x9e, 0xc5, 0x9b, 0xe2, 0x80, 0x9a, 0xe2, 0x89, 0xbb, 0xe2, 0xaa, 0xb4, 0xe2, 0xaa, 0xb8, 0xc5, 0xa1, 0xe2, 0x89, 0xbd, 0xe2, 0xaa, 0xb0, 0xc5, 0x9f, 0xc5, 0x9d, 0xe2, 0xaa, 0xb6, 0xe2, 0xaa, 0xba, 0xe2, 0x8b, 0xa9, 0xe2, 0xa8, 0x93, 0xe2, 0x89, 0xbf, 0xd1, 0x81, 0xe2, 0x8b, 0x85, 0xe2, 0x8a, 0xa1, 0xe2, 0xa9, 0xa6, 0xe2, 0x87, 0x98, 0xe2, 0xa4, 0xa5, 0xe2, 0x86, 0x98, 0xe2, 0x86, 0x98, 0xc2, 0xa7, 0x3b, 0xe2, 0xa4, 0xa9, 0xe2, 0x88, 0x96, 0xe2, 0x88, 0x96, 0xe2, 0x9c, 0xb6, 0xf0, 0x9d, 0x94, 0xb0, 0xe2, 0x8c, 0xa2, 0xe2, 0x99, 0xaf, 0xd1, 0x89, 0xd1, 0x88, 0xe2, 0x88, 0xa3, 0xe2, 0x88, 0xa5, 0xc2, 0xad, 0xcf, 0x83, 0xcf, 0x82, 0xcf, 0x82, 0xe2, 0x88, 0xbc, 0xe2, 0xa9, 0xaa, 0xe2, 0x89, 0x83, 0xe2, 0x89, 0x83, 0xe2, 0xaa, 0x9e, 0xe2, 0xaa, 0xa0, 0xe2, 0xaa, 0x9d, 0xe2, 0xaa, 0x9f, 0xe2, 0x89, 0x86, 0xe2, 0xa8, 0xa4, 0xe2, 0xa5, 0xb2, 0xe2, 0x86, 0x90, 0xe2, 0x88, 0x96, 0xe2, 0xa8, 0xb3, 0xe2, 0xa7, 0xa4, 0xe2, 0x88, 0xa3, 0xe2, 0x8c, 0xa3, 0xe2, 0xaa, 0xaa, 0xe2, 0xaa, 0xac, 0xe2, 0xaa, 0xac, 0xef, 0xb8, 0x80, 0xd1, 0x8c, 0x2f, 0xe2, 0xa7, 0x84, 0xe2, 0x8c, 0xbf, 0xf0, 0x9d, 0x95, 0xa4, 0xe2, 0x99, 0xa0, 0xe2, 0x99, 0xa0, 0xe2, 0x88, 0xa5, 0xe2, 0x8a, 0x93, 0xe2, 0x8a, 0x93, 0xef, 0xb8, 0x80, 0xe2, 0x8a, 0x94, 0xe2, 0x8a, 0x94, 0xef, 0xb8, 0x80, 0xe2, 0x8a, 0x8f, 0xe2, 0x8a, 0x91, 0xe2, 0x8a, 0x8f, 0xe2, 0x8a, 0x91, 0xe2, 0x8a, 0x90, 0xe2, 0x8a, 0x92, 0xe2, 0x8a, 0x90, 0xe2, 0x8a, 0x92, 0xe2, 0x96, 0xa1, 0xe2, 0x96, 0xa1, 0xe2, 0x96, 0xaa, 0xe2, 0x96, 0xaa, 0xe2, 0x86, 0x92, 0xf0, 0x9d, 0x93, 0x88, 0xe2, 0x88, 0x96, 0xe2, 0x8c, 0xa3, 0xe2, 0x8b, 0x86, 0xe2, 0x98, 0x86, 0xe2, 0x98, 0x85, 0xcf, 0xb5, 0xcf, 0x95, 0xc2, 0xaf, 0xe2, 0x8a, 0x82, 0xe2, 0xab, 0x85, 0xe2, 0xaa, 0xbd, 0xe2, 0x8a, 0x86, 0xe2, 0xab, 0x83, 0xe2, 0xab, 0x81, 0xe2, 0xab, 0x8b, 0xe2, 0x8a, 0x8a, 0xe2, 0xaa, 0xbf, 0xe2, 0xa5, 0xb9, 0xe2, 0x8a, 0x82, 0xe2, 0x8a, 0x86, 0xe2, 0xab, 0x85, 0xe2, 0x8a, 0x8a, 0xe2, 0xab, 0x8b, 0xe2, 0xab, 0x87, 0xe2, 0xab, 0x95, 0xe2, 0xab, 0x93, 0xe2, 0x89, 0xbb, 0xe2, 0xaa, 0xb8, 0xe2, 0x89, 0xbd, 0xe2, 0xaa, 0xb0, 0xe2, 0xaa, 0xba, 0xe2, 0xaa, 0xb6, 0xe2, 0x8b, 0xa9, 0xe2, 0x89, 0xbf, 0xe2, 0x88, 0x91, 0xe2, 0x99, 0xaa, 0xe2, 0x8a, 0x83, 0xc2, 0xb9, 0xc2, 0xb2, 0xc2, 0xb3, 0xe2, 0xab, 0x86, 0xe2, 0xaa, 0xbe, 0xe2, 0xab, 0x98, 0xe2, 0x8a, 0x87, 0xe2, 0xab, 0x84, 0xe2, 0x9f, 0x89, 0xe2, 0xab, 0x97, 0xe2, 0xa5, 0xbb, 0xe2, 0xab, 0x82, 0xe2, 0xab, 0x8c, 0xe2, 0x8a, 0x8b, 0xe2, 0xab, 0x80, 0xe2, 0x8a, 0x83, 0xe2, 0x8a, 0x87, 0xe2, 0xab, 0x86, 0xe2, 0x8a, 0x8b, 0xe2, 0xab, 0x8c, 0xe2, 0xab, 0x88, 0xe2, 0xab, 0x94, 0xe2, 0xab, 0x96, 0xe2, 0x87, 0x99, 0xe2, 0xa4, 0xa6, 0xe2, 0x86, 0x99, 0xe2, 0x86, 0x99, 0xe2, 0xa4, 0xaa, 0xc3, 0x9f, 0xe2, 0x8c, 0x96, 0xcf, 0x84, 0xe2, 0x8e, 0xb4, 0xc5, 0xa5, 0xc5, 0xa3, 0xd1, 0x82, 0xe2, 0x83, 0x9b, 0xe2, 0x8c, 0x95, 0xf0, 0x9d, 0x94, 0xb1, 0xe2, 0x88, 0xb4, 0xe2, 0x88, 0xb4, 0xce, 0xb8, 0xcf, 0x91, 0xcf, 0x91, 0xe2, 0x89, 0x88, 0xe2, 0x88, 0xbc, 0xe2, 0x80, 0x89, 0xe2, 0x89, 0x88, 0xe2, 0x88, 0xbc, 0xc3, 0xbe, 0xcb, 0x9c, 0xc3, 0x97, 0xe2, 0x8a, 0xa0, 0xe2, 0xa8, 0xb1, 0xe2, 0xa8, 0xb0, 0xe2, 0x88, 0xad, 0xe2, 0xa4, 0xa8, 0xe2, 0x8a, 0xa4, 0xe2, 0x8c, 0xb6, 0xe2, 0xab, 0xb1, 0xf0, 0x9d, 0x95, 0xa5, 0xe2, 0xab, 0x9a, 0xe2, 0xa4, 0xa9, 0xe2, 0x80, 0xb4, 0xe2, 0x84, 0xa2, 0xe2, 0x96, 0xb5, 0xe2, 0x96, 0xbf, 0xe2, 0x97, 0x83, 0xe2, 0x8a, 0xb4, 0xe2, 0x89, 0x9c, 0xe2, 0x96, 0xb9, 0xe2, 0x8a, 0xb5, 0xe2, 0x97, 0xac, 0xe2, 0x89, 0x9c, 0xe2, 0xa8, 0xba, 0xe2, 0xa8, 0xb9, 0xe2, 0xa7, 0x8d, 0xe2, 0xa8, 0xbb, 0xe2, 0x8f, 0xa2, 0xf0, 0x9d, 0x93, 0x89, 0xd1, 0x86, 0xd1, 0x9b, 0xc5, 0xa7, 0xe2, 0x89, 0xac, 0xe2, 0x86, 0x9e, 0xe2, 0x86, 0xa0, 0xe2, 0x87, 0x91, 0xe2, 0xa5, 0xa3, 0xc3, 0xba, 0xe2, 0x86, 0x91, 0xd1, 0x9e, 0xc5, 0xad, 0xc3, 0xbb, 0xd1, 0x83, 0xe2, 0x87, 0x85, 0xc5, 0xb1, 0xe2, 0xa5, 0xae, 0xe2, 0xa5, 0xbe, 0xf0, 0x9d, 0x94, 0xb2, 0xc3, 0xb9, 0xe2, 0x86, 0xbf, 0xe2, 0x86, 0xbe, 0xe2, 0x96, 0x80, 0xe2, 0x8c, 0x9c, 0xe2, 0x8c, 0x9c, 0xe2, 0x8c, 0x8f, 0xe2, 0x97, 0xb8, 0xc5, 0xab, 0xc2, 0xa8, 0xc5, 0xb3, 0xf0, 0x9d, 0x95, 0xa6, 0xe2, 0x86, 0x91, 0xe2, 0x86, 0x95, 0xe2, 0x86, 0xbf, 0xe2, 0x86, 0xbe, 0xe2, 0x8a, 0x8e, 0xcf, 0x85, 0xcf, 0x92, 0xcf, 0x85, 0xe2, 0x87, 0x88, 0xe2, 0x8c, 0x9d, 0xe2, 0x8c, 0x9d, 0xe2, 0x8c, 0x8e, 0xc5, 0xaf, 0xe2, 0x97, 0xb9, 0xf0, 0x9d, 0x93, 0x8a, 0xe2, 0x8b, 0xb0, 0xc5, 0xa9, 0xe2, 0x96, 0xb5, 0xe2, 0x96, 0xb4, 0xe2, 0x87, 0x88, 0xc3, 0xbc, 0xe2, 0xa6, 0xa7, 0xe2, 0x87, 0x95, 0xe2, 0xab, 0xa8, 0xe2, 0xab, 0xa9, 0xe2, 0x8a, 0xa8, 0xe2, 0xa6, 0x9c, 0xcf, 0xb5, 0xcf, 0xb0, 0xe2, 0x88, 0x85, 0xcf, 0x95, 0xcf, 0x96, 0xe2, 0x88, 0x9d, 0xe2, 0x86, 0x95, 0xcf, 0xb1, 0xcf, 0x82, 0xe2, 0x8a, 0x8a, 0xef, 0xb8, 0x80, 0xe2, 0xab, 0x8b, 0xef, 0xb8, 0x80, 0xe2, 0x8a, 0x8b, 0xef, 0xb8, 0x80, 0xe2, 0xab, 0x8c, 0xef, 0xb8, 0x80, 0xcf, 0x91, 0xe2, 0x8a, 0xb2, 0xe2, 0x8a, 0xb3, 0xd0, 0xb2, 0xe2, 0x8a, 0xa2, 0xe2, 0x88, 0xa8, 0xe2, 0x8a, 0xbb, 0xe2, 0x89, 0x9a, 0xe2, 0x8b, 0xae, 0x7c, 0x7c, 0xf0, 0x9d, 0x94, 0xb3, 0xe2, 0x8a, 0xb2, 0xe2, 0x8a, 0x82, 0xe2, 0x83, 0x92, 0xe2, 0x8a, 0x83, 0xe2, 0x83, 0x92, 0xf0, 0x9d, 0x95, 0xa7, 0xe2, 0x88, 0x9d, 0xe2, 0x8a, 0xb3, 0xf0, 0x9d, 0x93, 0x8b, 0xe2, 0xab, 0x8b, 0xef, 0xb8, 0x80, 0xe2, 0x8a, 0x8a, 0xef, 0xb8, 0x80, 0xe2, 0xab, 0x8c, 0xef, 0xb8, 0x80, 0xe2, 0x8a, 0x8b, 0xef, 0xb8, 0x80, 0xe2, 0xa6, 0x9a, 0xc5, 0xb5, 0xe2, 0xa9, 0x9f, 0xe2, 0x88, 0xa7, 0xe2, 0x89, 0x99, 0xe2, 0x84, 0x98, 0xf0, 0x9d, 0x94, 0xb4, 0xf0, 0x9d, 0x95, 0xa8, 0xe2, 0x84, 0x98, 0xe2, 0x89, 0x80, 0xe2, 0x89, 0x80, 0xf0, 0x9d, 0x93, 0x8c, 0xe2, 0x8b, 0x82, 0xe2, 0x97, 0xaf, 0xe2, 0x8b, 0x83, 0xe2, 0x96, 0xbd, 0xf0, 0x9d, 0x94, 0xb5, 0xe2, 0x9f, 0xba, 0xe2, 0x9f, 0xb7, 0xce, 0xbe, 0xe2, 0x9f, 0xb8, 0xe2, 0x9f, 0xb5, 0xe2, 0x9f, 0xbc, 0xe2, 0x8b, 0xbb, 0xe2, 0xa8, 0x80, 0xf0, 0x9d, 0x95, 0xa9, 0xe2, 0xa8, 0x81, 0xe2, 0xa8, 0x82, 0xe2, 0x9f, 0xb9, 0xe2, 0x9f, 0xb6, 0xf0, 0x9d, 0x93, 0x8d, 0xe2, 0xa8, 0x86, 0xe2, 0xa8, 0x84, 0xe2, 0x96, 0xb3, 0xe2, 0x8b, 0x81, 0xe2, 0x8b, 0x80, 0xc3, 0xbd, 0xd1, 0x8f, 0xc5, 0xb7, 0xd1, 0x8b, 0xc2, 0xa5, 0xf0, 0x9d, 0x94, 0xb6, 0xd1, 0x97, 0xf0, 0x9d, 0x95, 0xaa, 0xf0, 0x9d, 0x93, 0x8e, 0xd1, 0x8e, 0xc3, 0xbf, 0xc5, 0xba, 0xc5, 0xbe, 0xd0, 0xb7, 0xc5, 0xbc, 0xe2, 0x84, 0xa8, 0xce, 0xb6, 0xf0, 0x9d, 0x94, 0xb7, 0xd0, 0xb6, 0xe2, 0x87, 0x9d, 0xf0, 0x9d, 0x95, 0xab, 0xf0, 0x9d, 0x93, 0x8f, 0xe2, 0x80, 0x8d, 0xe2, 0x80, 0x8c} +var _html5entitiesCharactersIndex = "\x02\x01\x02\x02\x02\x04\x02\x02\x02\x03\x02\x04\x03\x02\x04\x03\x02\x02\x03\x03\x03\x02\x03\x03\x02\x04\x04\x02\x03\x03\x02\x02\x02\x03\x03\x03\x02\x02\x02\x03\x02\x02\x02\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x03\x03\x02\x02\x02\x03\x03\x03\x02\x02\x03\x02\x04\x02\x02\x02\x01\x02\x03\x03\x04\x02\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x02\x02\x02\x02\x02\x02\x02\x02\x04\x02\x03\x02\x03\x03\x02\x04\x02\x03\x03\x03\x03\x03\x02\x02\x03\x03\x02\x04\x03\x03\x04\x03\x03\x03\x02\x01\x02\x02\x02\x02\x02\x02\x02\x04\x03\x04\x03\x03\x03\x03\x03\x03\x03\x04\x03\x02\x02\x01\x02\x03\x03\x03\x03\x03\x02\x03\x03\x02\x02\x02\x02\x02\x02\x02\x03\x02\x03\x02\x03\x03\x03\x03\x03\x03\x03\x02\x04\x02\x03\x02\x02\x02\x02\x02\x04\x04\x04\x02\x02\x02\x02\x02\x02\x02\x04\x04\x04\x02\x01\x02\x02\x03\x03\x03\x02\x02\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x02\x03\x03\x03\x03\x03\x03\x04\x03\x03\x03\x03\x02\x03\x03\x02\x03\x03\x04\x03\x04\x03\x02\x02\x02\x02\x02\x02\x03\x03\x03\x03\x03\x03\x01\x04\x03\x02\x03\x03\x03\x03\x03\x03\x03\x05\x03\x03\x03\x05\x05\x03\x05\x03\x05\x05\x03\x05\x03\x03\x03\x03\x05\x05\x03\x05\x05\x03\x05\x03\x03\x03\x05\x03\x05\x03\x05\x03\x06\x03\x03\x05\x03\x05\x06\x03\x03\x03\x03\x03\x03\x04\x02\x02\x02\x02\x02\x02\x02\x04\x02\x02\x02\x02\x04\x03\x03\x03\x04\x02\x02\x03\x02\x03\x03\x03\x03\x03\x02\x04\x02\x02\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x02\x01\x04\x03\x04\x03\x02\x02\x03\x03\x03\x02\x02\x02\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x02\x02\x02\x03\x02\x02\x02\x02\x04\x03\x03\x03\x03\x02\x03\x04\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x02\x02\x01\x02\x02\x02\x02\x04\x03\x02\x06\x03\x03\x03\x03\x03\x04\x03\x04\x02\x02\x03\x03\x02\x02\x02\x02\x02\x04\x02\x02\x01\x03\x03\x03\x03\x03\x02\x04\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x02\x02\x04\x02\x02\x03\x03\x02\x03\x03\x03\x03\x03\x03\x01\x03\x03\x03\x04\x04\x04\x03\x02\x03\x04\x04\x04\x04\x02\x04\x04\x02\x02\x02\x02\x02\x02\x04\x04\x04\x02\x02\x02\x02\x02\x02\x03\x02\x03\x03\x04\x02\x02\x03\x05\x03\x02\x02\x02\x02\x03\x04\x02\x03\x03\x02\x02\x03\x01\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x02\x04\x03\x03\x03\x03\x03\x01\x03\x03\x02\x04\x01\x03\x03\x02\x02\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x02\x03\x02\x03\x03\x04\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x06\x03\x04\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x02\x04\x03\x03\x03\x01\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x06\x03\x02\x03\x02\x02\x02\x03\x03\x02\x02\x03\x02\x02\x04\x02\x03\x03\x02\x03\x03\x02\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x01\x03\x03\x01\x01\x03\x03\x03\x03\x03\x03\x03\x04\x03\x02\x03\x03\x03\x04\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x06\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x02\x02\x03\x03\x03\x03\x02\x02\x03\x03\x04\x03\x03\x03\x03\x03\x03\x02\x02\x03\x02\x02\x03\x03\x02\x03\x03\x01\x04\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x02\x03\x02\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x02\x03\x02\x03\x02\x03\x02\x02\x03\x03\x04\x03\x02\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x02\x03\x02\x04\x03\x03\x03\x02\x02\x02\x03\x03\x03\x03\x03\x01\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x02\x02\x03\x01\x03\x03\x03\x03\x02\x03\x03\x03\x03\x04\x03\x02\x03\x03\x03\x02\x04\x03\x03\x03\x03\x02\x03\x02\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x02\x02\x02\x03\x02\x02\x02\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x06\x03\x04\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x01\x03\x03\x03\x03\x01\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x06\x06\x03\x03\x02\x03\x02\x03\x03\x03\x03\x02\x03\x03\x03\x03\x04\x03\x03\x03\x03\x03\x03\x04\x03\x04\x03\x02\x03\x03\x02\x03\x02\x02\x02\x02\x03\x04\x02\x03\x03\x03\x03\x03\x02\x02\x03\x03\x03\x02\x03\x02\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x02\x02\x04\x02\x03\x02\x04\x03\x03\x03\x03\x03\x03\x03\x02\x02\x02\x02\x02\x04\x02\x04\x04\x02\x02\x02\x02\x02\x02\x04\x02\x02\x02\x04\x04\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x02\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x06\x03\x03\x01\x01\x03\x03\x03\x02\x02\x03\x01\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x06\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x03\x01\x03\x03\x03\x01\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x03\x03\x01\x03\x03\x02\x01\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x06\x06\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x04\x03\x02\x03\x01\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x04\x03\x02\x03\x03\x05\x06\x05\x03\x03\x05\x06\x05\x03\x03\x03\x03\x02\x06\x03\x05\x05\x02\x03\x03\x03\x03\x02\x05\x05\x03\x02\x02\x03\x05\x03\x02\x03\x03\x03\x03\x03\x03\x05\x03\x03\x05\x03\x03\x04\x05\x03\x03\x05\x05\x05\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x05\x03\x03\x03\x03\x03\x03\x05\x05\x05\x03\x03\x03\x03\x03\x03\x04\x02\x03\x05\x05\x03\x03\x03\x03\x03\x03\x03\x03\x03\x06\x05\x03\x03\x03\x05\x03\x05\x03\x03\x05\x05\x03\x03\x03\x03\x03\x05\x04\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x05\x03\x06\x03\x05\x03\x05\x03\x05\x03\x06\x03\x05\x03\x02\x03\x03\x03\x03\x03\x02\x01\x03\x03\x03\x03\x06\x03\x06\x04\x03\x03\x06\x04\x06\x03\x06\x06\x03\x03\x03\x03\x03\x03\x02\x03\x03\x02\x02\x03\x02\x03\x03\x03\x02\x03\x04\x02\x02\x03\x03\x02\x03\x03\x03\x03\x03\x03\x02\x02\x02\x03\x03\x04\x03\x03\x03\x03\x03\x03\x03\x03\x02\x02\x03\x03\x03\x03\x03\x02\x03\x02\x03\x03\x02\x03\x03\x02\x03\x03\x03\x03\x02\x01\x01\x03\x03\x03\x04\x02\x02\x03\x03\x02\x03\x02\x03\x03\x03\x01\x03\x03\x03\x03\x03\x03\x02\x03\x03\x02\x03\x04\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x02\x03\x04\x03\x04\x03\x04\x03\x03\x01\x03\x01\x03\x03\x03\x03\x03\x05\x02\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x01\x01\x03\x03\x03\x02\x02\x03\x01\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x04\x03\x03\x03\x02\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x01\x03\x03\x03\x03\x04\x03\x01\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x02\x03\x03\x02\x02\x03\x03\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x03\x02\x01\x03\x03\x03\x03\x04\x03\x03\x02\x02\x03\x03\x02\x02\x02\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x06\x02\x01\x03\x03\x04\x03\x03\x03\x03\x06\x03\x06\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x03\x03\x03\x02\x02\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x02\x02\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x02\x03\x02\x03\x02\x02\x02\x03\x03\x04\x03\x03\x02\x02\x02\x03\x03\x03\x03\x03\x02\x02\x02\x03\x03\x03\x03\x03\x03\x03\x03\x04\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x03\x04\x02\x02\x02\x03\x03\x03\x03\x03\x02\x03\x02\x02\x02\x02\x03\x02\x03\x03\x04\x02\x03\x03\x03\x03\x03\x03\x03\x02\x02\x02\x04\x03\x03\x03\x03\x03\x02\x02\x02\x03\x03\x03\x03\x02\x03\x04\x03\x02\x03\x03\x03\x02\x03\x03\x03\x03\x03\x03\x02\x02\x03\x02\x02\x03\x03\x02\x02\x06\x06\x06\x06\x02\x03\x03\x02\x03\x03\x03\x03\x03\x01\x01\x04\x03\x06\x06\x04\x03\x03\x04\x06\x06\x06\x06\x03\x02\x03\x03\x03\x03\x04\x04\x03\x03\x03\x04\x03\x03\x03\x03\x04\x03\x03\x02\x03\x03\x03\x03\x03\x04\x03\x03\x03\x03\x04\x03\x03\x03\x03\x03\x02\x02\x02\x02\x02\x04\x02\x04\x04\x02\x02\x02\x02\x02\x02\x03\x02\x04\x02\x03\x04\x04\x03\x03" diff --git a/util/html5entities.go b/util/html5entities.go new file mode 100644 index 0000000..284dc05 --- /dev/null +++ b/util/html5entities.go @@ -0,0 +1,47 @@ +package util + +import ( + "sync" +) + +//go:generate go run ../_tools emb-structs -i ../_tools/html5entities.json -o ./html5entities.gen.go + +var _html5entitiesOnce sync.Once +var _html5entitiesMap map[string]*HTML5Entity + +func buildHTML5Entities() { + _html5entitiesOnce.Do(func() { + entities := make([]HTML5Entity, _html5entitiesLength) + _html5entitiesMap = make(map[string]*HTML5Entity, _html5entitiesLength) + + cName := 0 + cCharacters := 0 + for i := range _html5entitiesLength { + tName := cName + int(_html5entitiesNameIndex[i]) + tCharacters := cCharacters + int(_html5entitiesCharactersIndex[i]) + + name := _html5entitiesName[cName:tName] + e := &entities[i] + e.Name = name + e.Characters = _html5entitiesCharacters[cCharacters:tCharacters] + _html5entitiesMap[name] = e + + cName = tName + cCharacters = tCharacters + } + }) +} + +// HTML5Entity struct represents HTML5 entitites. +type HTML5Entity struct { + Name string + Characters []byte +} + +// LookUpHTML5EntityByName returns (an HTML5Entity, true) if an entity named +// given name is found, otherwise (nil, false). +func LookUpHTML5EntityByName(name string) (*HTML5Entity, bool) { + buildHTML5Entities() + v, ok := _html5entitiesMap[name] + return v, ok +} diff --git a/util/unicode_case_folding.gen.go b/util/unicode_case_folding.gen.go new file mode 100644 index 0000000..eb91fb2 --- /dev/null +++ b/util/unicode_case_folding.gen.go @@ -0,0 +1,6 @@ +// Code generated by _tools; DO NOT EDIT. +package util +const _unicodeCaseFoldingLength = 1530 +var _unicodeCaseFoldingFrom = [...]rune{0x41, 0x42, 0x43, 0x44, 0x45, 0x46, 0x47, 0x48, 0x49, 0x4a, 0x4b, 0x4c, 0x4d, 0x4e, 0x4f, 0x50, 0x51, 0x52, 0x53, 0x54, 0x55, 0x56, 0x57, 0x58, 0x59, 0x5a, 0xb5, 0xc0, 0xc1, 0xc2, 0xc3, 0xc4, 0xc5, 0xc6, 0xc7, 0xc8, 0xc9, 0xca, 0xcb, 0xcc, 0xcd, 0xce, 0xcf, 0xd0, 0xd1, 0xd2, 0xd3, 0xd4, 0xd5, 0xd6, 0xd8, 0xd9, 0xda, 0xdb, 0xdc, 0xdd, 0xde, 0xdf, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10e, 0x110, 0x112, 0x114, 0x116, 0x118, 0x11a, 0x11c, 0x11e, 0x120, 0x122, 0x124, 0x126, 0x128, 0x12a, 0x12c, 0x12e, 0x130, 0x132, 0x134, 0x136, 0x139, 0x13b, 0x13d, 0x13f, 0x141, 0x143, 0x145, 0x147, 0x149, 0x14a, 0x14c, 0x14e, 0x150, 0x152, 0x154, 0x156, 0x158, 0x15a, 0x15c, 0x15e, 0x160, 0x162, 0x164, 0x166, 0x168, 0x16a, 0x16c, 0x16e, 0x170, 0x172, 0x174, 0x176, 0x178, 0x179, 0x17b, 0x17d, 0x17f, 0x181, 0x182, 0x184, 0x186, 0x187, 0x189, 0x18a, 0x18b, 0x18e, 0x18f, 0x190, 0x191, 0x193, 0x194, 0x196, 0x197, 0x198, 0x19c, 0x19d, 0x19f, 0x1a0, 0x1a2, 0x1a4, 0x1a6, 0x1a7, 0x1a9, 0x1ac, 0x1ae, 0x1af, 0x1b1, 0x1b2, 0x1b3, 0x1b5, 0x1b7, 0x1b8, 0x1bc, 0x1c4, 0x1c5, 0x1c7, 0x1c8, 0x1ca, 0x1cb, 0x1cd, 0x1cf, 0x1d1, 0x1d3, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1de, 0x1e0, 0x1e2, 0x1e4, 0x1e6, 0x1e8, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f1, 0x1f2, 0x1f4, 0x1f6, 0x1f7, 0x1f8, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x202, 0x204, 0x206, 0x208, 0x20a, 0x20c, 0x20e, 0x210, 0x212, 0x214, 0x216, 0x218, 0x21a, 0x21c, 0x21e, 0x220, 0x222, 0x224, 0x226, 0x228, 0x22a, 0x22c, 0x22e, 0x230, 0x232, 0x23a, 0x23b, 0x23d, 0x23e, 0x241, 0x243, 0x244, 0x245, 0x246, 0x248, 0x24a, 0x24c, 0x24e, 0x345, 0x370, 0x372, 0x376, 0x37f, 0x386, 0x388, 0x389, 0x38a, 0x38c, 0x38e, 0x38f, 0x390, 0x391, 0x392, 0x393, 0x394, 0x395, 0x396, 0x397, 0x398, 0x399, 0x39a, 0x39b, 0x39c, 0x39d, 0x39e, 0x39f, 0x3a0, 0x3a1, 0x3a3, 0x3a4, 0x3a5, 0x3a6, 0x3a7, 0x3a8, 0x3a9, 0x3aa, 0x3ab, 0x3b0, 0x3c2, 0x3cf, 0x3d0, 0x3d1, 0x3d5, 0x3d6, 0x3d8, 0x3da, 0x3dc, 0x3de, 0x3e0, 0x3e2, 0x3e4, 0x3e6, 0x3e8, 0x3ea, 0x3ec, 0x3ee, 0x3f0, 0x3f1, 0x3f4, 0x3f5, 0x3f7, 0x3f9, 0x3fa, 0x3fd, 0x3fe, 0x3ff, 0x400, 0x401, 0x402, 0x403, 0x404, 0x405, 0x406, 0x407, 0x408, 0x409, 0x40a, 0x40b, 0x40c, 0x40d, 0x40e, 0x40f, 0x410, 0x411, 0x412, 0x413, 0x414, 0x415, 0x416, 0x417, 0x418, 0x419, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x41f, 0x420, 0x421, 0x422, 0x423, 0x424, 0x425, 0x426, 0x427, 0x428, 0x429, 0x42a, 0x42b, 0x42c, 0x42d, 0x42e, 0x42f, 0x460, 0x462, 0x464, 0x466, 0x468, 0x46a, 0x46c, 0x46e, 0x470, 0x472, 0x474, 0x476, 0x478, 0x47a, 0x47c, 0x47e, 0x480, 0x48a, 0x48c, 0x48e, 0x490, 0x492, 0x494, 0x496, 0x498, 0x49a, 0x49c, 0x49e, 0x4a0, 0x4a2, 0x4a4, 0x4a6, 0x4a8, 0x4aa, 0x4ac, 0x4ae, 0x4b0, 0x4b2, 0x4b4, 0x4b6, 0x4b8, 0x4ba, 0x4bc, 0x4be, 0x4c0, 0x4c1, 0x4c3, 0x4c5, 0x4c7, 0x4c9, 0x4cb, 0x4cd, 0x4d0, 0x4d2, 0x4d4, 0x4d6, 0x4d8, 0x4da, 0x4dc, 0x4de, 0x4e0, 0x4e2, 0x4e4, 0x4e6, 0x4e8, 0x4ea, 0x4ec, 0x4ee, 0x4f0, 0x4f2, 0x4f4, 0x4f6, 0x4f8, 0x4fa, 0x4fc, 0x4fe, 0x500, 0x502, 0x504, 0x506, 0x508, 0x50a, 0x50c, 0x50e, 0x510, 0x512, 0x514, 0x516, 0x518, 0x51a, 0x51c, 0x51e, 0x520, 0x522, 0x524, 0x526, 0x528, 0x52a, 0x52c, 0x52e, 0x531, 0x532, 0x533, 0x534, 0x535, 0x536, 0x537, 0x538, 0x539, 0x53a, 0x53b, 0x53c, 0x53d, 0x53e, 0x53f, 0x540, 0x541, 0x542, 0x543, 0x544, 0x545, 0x546, 0x547, 0x548, 0x549, 0x54a, 0x54b, 0x54c, 0x54d, 0x54e, 0x54f, 0x550, 0x551, 0x552, 0x553, 0x554, 0x555, 0x556, 0x587, 0x10a0, 0x10a1, 0x10a2, 0x10a3, 0x10a4, 0x10a5, 0x10a6, 0x10a7, 0x10a8, 0x10a9, 0x10aa, 0x10ab, 0x10ac, 0x10ad, 0x10ae, 0x10af, 0x10b0, 0x10b1, 0x10b2, 0x10b3, 0x10b4, 0x10b5, 0x10b6, 0x10b7, 0x10b8, 0x10b9, 0x10ba, 0x10bb, 0x10bc, 0x10bd, 0x10be, 0x10bf, 0x10c0, 0x10c1, 0x10c2, 0x10c3, 0x10c4, 0x10c5, 0x10c7, 0x10cd, 0x13f8, 0x13f9, 0x13fa, 0x13fb, 0x13fc, 0x13fd, 0x1c80, 0x1c81, 0x1c82, 0x1c83, 0x1c84, 0x1c85, 0x1c86, 0x1c87, 0x1c88, 0x1c90, 0x1c91, 0x1c92, 0x1c93, 0x1c94, 0x1c95, 0x1c96, 0x1c97, 0x1c98, 0x1c99, 0x1c9a, 0x1c9b, 0x1c9c, 0x1c9d, 0x1c9e, 0x1c9f, 0x1ca0, 0x1ca1, 0x1ca2, 0x1ca3, 0x1ca4, 0x1ca5, 0x1ca6, 0x1ca7, 0x1ca8, 0x1ca9, 0x1caa, 0x1cab, 0x1cac, 0x1cad, 0x1cae, 0x1caf, 0x1cb0, 0x1cb1, 0x1cb2, 0x1cb3, 0x1cb4, 0x1cb5, 0x1cb6, 0x1cb7, 0x1cb8, 0x1cb9, 0x1cba, 0x1cbd, 0x1cbe, 0x1cbf, 0x1e00, 0x1e02, 0x1e04, 0x1e06, 0x1e08, 0x1e0a, 0x1e0c, 0x1e0e, 0x1e10, 0x1e12, 0x1e14, 0x1e16, 0x1e18, 0x1e1a, 0x1e1c, 0x1e1e, 0x1e20, 0x1e22, 0x1e24, 0x1e26, 0x1e28, 0x1e2a, 0x1e2c, 0x1e2e, 0x1e30, 0x1e32, 0x1e34, 0x1e36, 0x1e38, 0x1e3a, 0x1e3c, 0x1e3e, 0x1e40, 0x1e42, 0x1e44, 0x1e46, 0x1e48, 0x1e4a, 0x1e4c, 0x1e4e, 0x1e50, 0x1e52, 0x1e54, 0x1e56, 0x1e58, 0x1e5a, 0x1e5c, 0x1e5e, 0x1e60, 0x1e62, 0x1e64, 0x1e66, 0x1e68, 0x1e6a, 0x1e6c, 0x1e6e, 0x1e70, 0x1e72, 0x1e74, 0x1e76, 0x1e78, 0x1e7a, 0x1e7c, 0x1e7e, 0x1e80, 0x1e82, 0x1e84, 0x1e86, 0x1e88, 0x1e8a, 0x1e8c, 0x1e8e, 0x1e90, 0x1e92, 0x1e94, 0x1e96, 0x1e97, 0x1e98, 0x1e99, 0x1e9a, 0x1e9b, 0x1e9e, 0x1ea0, 0x1ea2, 0x1ea4, 0x1ea6, 0x1ea8, 0x1eaa, 0x1eac, 0x1eae, 0x1eb0, 0x1eb2, 0x1eb4, 0x1eb6, 0x1eb8, 0x1eba, 0x1ebc, 0x1ebe, 0x1ec0, 0x1ec2, 0x1ec4, 0x1ec6, 0x1ec8, 0x1eca, 0x1ecc, 0x1ece, 0x1ed0, 0x1ed2, 0x1ed4, 0x1ed6, 0x1ed8, 0x1eda, 0x1edc, 0x1ede, 0x1ee0, 0x1ee2, 0x1ee4, 0x1ee6, 0x1ee8, 0x1eea, 0x1eec, 0x1eee, 0x1ef0, 0x1ef2, 0x1ef4, 0x1ef6, 0x1ef8, 0x1efa, 0x1efc, 0x1efe, 0x1f08, 0x1f09, 0x1f0a, 0x1f0b, 0x1f0c, 0x1f0d, 0x1f0e, 0x1f0f, 0x1f18, 0x1f19, 0x1f1a, 0x1f1b, 0x1f1c, 0x1f1d, 0x1f28, 0x1f29, 0x1f2a, 0x1f2b, 0x1f2c, 0x1f2d, 0x1f2e, 0x1f2f, 0x1f38, 0x1f39, 0x1f3a, 0x1f3b, 0x1f3c, 0x1f3d, 0x1f3e, 0x1f3f, 0x1f48, 0x1f49, 0x1f4a, 0x1f4b, 0x1f4c, 0x1f4d, 0x1f50, 0x1f52, 0x1f54, 0x1f56, 0x1f59, 0x1f5b, 0x1f5d, 0x1f5f, 0x1f68, 0x1f69, 0x1f6a, 0x1f6b, 0x1f6c, 0x1f6d, 0x1f6e, 0x1f6f, 0x1f80, 0x1f81, 0x1f82, 0x1f83, 0x1f84, 0x1f85, 0x1f86, 0x1f87, 0x1f88, 0x1f89, 0x1f8a, 0x1f8b, 0x1f8c, 0x1f8d, 0x1f8e, 0x1f8f, 0x1f90, 0x1f91, 0x1f92, 0x1f93, 0x1f94, 0x1f95, 0x1f96, 0x1f97, 0x1f98, 0x1f99, 0x1f9a, 0x1f9b, 0x1f9c, 0x1f9d, 0x1f9e, 0x1f9f, 0x1fa0, 0x1fa1, 0x1fa2, 0x1fa3, 0x1fa4, 0x1fa5, 0x1fa6, 0x1fa7, 0x1fa8, 0x1fa9, 0x1faa, 0x1fab, 0x1fac, 0x1fad, 0x1fae, 0x1faf, 0x1fb2, 0x1fb3, 0x1fb4, 0x1fb6, 0x1fb7, 0x1fb8, 0x1fb9, 0x1fba, 0x1fbb, 0x1fbc, 0x1fbe, 0x1fc2, 0x1fc3, 0x1fc4, 0x1fc6, 0x1fc7, 0x1fc8, 0x1fc9, 0x1fca, 0x1fcb, 0x1fcc, 0x1fd2, 0x1fd3, 0x1fd6, 0x1fd7, 0x1fd8, 0x1fd9, 0x1fda, 0x1fdb, 0x1fe2, 0x1fe3, 0x1fe4, 0x1fe6, 0x1fe7, 0x1fe8, 0x1fe9, 0x1fea, 0x1feb, 0x1fec, 0x1ff2, 0x1ff3, 0x1ff4, 0x1ff6, 0x1ff7, 0x1ff8, 0x1ff9, 0x1ffa, 0x1ffb, 0x1ffc, 0x2126, 0x212a, 0x212b, 0x2132, 0x2160, 0x2161, 0x2162, 0x2163, 0x2164, 0x2165, 0x2166, 0x2167, 0x2168, 0x2169, 0x216a, 0x216b, 0x216c, 0x216d, 0x216e, 0x216f, 0x2183, 0x24b6, 0x24b7, 0x24b8, 0x24b9, 0x24ba, 0x24bb, 0x24bc, 0x24bd, 0x24be, 0x24bf, 0x24c0, 0x24c1, 0x24c2, 0x24c3, 0x24c4, 0x24c5, 0x24c6, 0x24c7, 0x24c8, 0x24c9, 0x24ca, 0x24cb, 0x24cc, 0x24cd, 0x24ce, 0x24cf, 0x2c00, 0x2c01, 0x2c02, 0x2c03, 0x2c04, 0x2c05, 0x2c06, 0x2c07, 0x2c08, 0x2c09, 0x2c0a, 0x2c0b, 0x2c0c, 0x2c0d, 0x2c0e, 0x2c0f, 0x2c10, 0x2c11, 0x2c12, 0x2c13, 0x2c14, 0x2c15, 0x2c16, 0x2c17, 0x2c18, 0x2c19, 0x2c1a, 0x2c1b, 0x2c1c, 0x2c1d, 0x2c1e, 0x2c1f, 0x2c20, 0x2c21, 0x2c22, 0x2c23, 0x2c24, 0x2c25, 0x2c26, 0x2c27, 0x2c28, 0x2c29, 0x2c2a, 0x2c2b, 0x2c2c, 0x2c2d, 0x2c2e, 0x2c2f, 0x2c60, 0x2c62, 0x2c63, 0x2c64, 0x2c67, 0x2c69, 0x2c6b, 0x2c6d, 0x2c6e, 0x2c6f, 0x2c70, 0x2c72, 0x2c75, 0x2c7e, 0x2c7f, 0x2c80, 0x2c82, 0x2c84, 0x2c86, 0x2c88, 0x2c8a, 0x2c8c, 0x2c8e, 0x2c90, 0x2c92, 0x2c94, 0x2c96, 0x2c98, 0x2c9a, 0x2c9c, 0x2c9e, 0x2ca0, 0x2ca2, 0x2ca4, 0x2ca6, 0x2ca8, 0x2caa, 0x2cac, 0x2cae, 0x2cb0, 0x2cb2, 0x2cb4, 0x2cb6, 0x2cb8, 0x2cba, 0x2cbc, 0x2cbe, 0x2cc0, 0x2cc2, 0x2cc4, 0x2cc6, 0x2cc8, 0x2cca, 0x2ccc, 0x2cce, 0x2cd0, 0x2cd2, 0x2cd4, 0x2cd6, 0x2cd8, 0x2cda, 0x2cdc, 0x2cde, 0x2ce0, 0x2ce2, 0x2ceb, 0x2ced, 0x2cf2, 0xa640, 0xa642, 0xa644, 0xa646, 0xa648, 0xa64a, 0xa64c, 0xa64e, 0xa650, 0xa652, 0xa654, 0xa656, 0xa658, 0xa65a, 0xa65c, 0xa65e, 0xa660, 0xa662, 0xa664, 0xa666, 0xa668, 0xa66a, 0xa66c, 0xa680, 0xa682, 0xa684, 0xa686, 0xa688, 0xa68a, 0xa68c, 0xa68e, 0xa690, 0xa692, 0xa694, 0xa696, 0xa698, 0xa69a, 0xa722, 0xa724, 0xa726, 0xa728, 0xa72a, 0xa72c, 0xa72e, 0xa732, 0xa734, 0xa736, 0xa738, 0xa73a, 0xa73c, 0xa73e, 0xa740, 0xa742, 0xa744, 0xa746, 0xa748, 0xa74a, 0xa74c, 0xa74e, 0xa750, 0xa752, 0xa754, 0xa756, 0xa758, 0xa75a, 0xa75c, 0xa75e, 0xa760, 0xa762, 0xa764, 0xa766, 0xa768, 0xa76a, 0xa76c, 0xa76e, 0xa779, 0xa77b, 0xa77d, 0xa77e, 0xa780, 0xa782, 0xa784, 0xa786, 0xa78b, 0xa78d, 0xa790, 0xa792, 0xa796, 0xa798, 0xa79a, 0xa79c, 0xa79e, 0xa7a0, 0xa7a2, 0xa7a4, 0xa7a6, 0xa7a8, 0xa7aa, 0xa7ab, 0xa7ac, 0xa7ad, 0xa7ae, 0xa7b0, 0xa7b1, 0xa7b2, 0xa7b3, 0xa7b4, 0xa7b6, 0xa7b8, 0xa7ba, 0xa7bc, 0xa7be, 0xa7c0, 0xa7c2, 0xa7c4, 0xa7c5, 0xa7c6, 0xa7c7, 0xa7c9, 0xa7d0, 0xa7d6, 0xa7d8, 0xa7f5, 0xab70, 0xab71, 0xab72, 0xab73, 0xab74, 0xab75, 0xab76, 0xab77, 0xab78, 0xab79, 0xab7a, 0xab7b, 0xab7c, 0xab7d, 0xab7e, 0xab7f, 0xab80, 0xab81, 0xab82, 0xab83, 0xab84, 0xab85, 0xab86, 0xab87, 0xab88, 0xab89, 0xab8a, 0xab8b, 0xab8c, 0xab8d, 0xab8e, 0xab8f, 0xab90, 0xab91, 0xab92, 0xab93, 0xab94, 0xab95, 0xab96, 0xab97, 0xab98, 0xab99, 0xab9a, 0xab9b, 0xab9c, 0xab9d, 0xab9e, 0xab9f, 0xaba0, 0xaba1, 0xaba2, 0xaba3, 0xaba4, 0xaba5, 0xaba6, 0xaba7, 0xaba8, 0xaba9, 0xabaa, 0xabab, 0xabac, 0xabad, 0xabae, 0xabaf, 0xabb0, 0xabb1, 0xabb2, 0xabb3, 0xabb4, 0xabb5, 0xabb6, 0xabb7, 0xabb8, 0xabb9, 0xabba, 0xabbb, 0xabbc, 0xabbd, 0xabbe, 0xabbf, 0xfb00, 0xfb01, 0xfb02, 0xfb03, 0xfb04, 0xfb05, 0xfb06, 0xfb13, 0xfb14, 0xfb15, 0xfb16, 0xfb17, 0xff21, 0xff22, 0xff23, 0xff24, 0xff25, 0xff26, 0xff27, 0xff28, 0xff29, 0xff2a, 0xff2b, 0xff2c, 0xff2d, 0xff2e, 0xff2f, 0xff30, 0xff31, 0xff32, 0xff33, 0xff34, 0xff35, 0xff36, 0xff37, 0xff38, 0xff39, 0xff3a, 0x10400, 0x10401, 0x10402, 0x10403, 0x10404, 0x10405, 0x10406, 0x10407, 0x10408, 0x10409, 0x1040a, 0x1040b, 0x1040c, 0x1040d, 0x1040e, 0x1040f, 0x10410, 0x10411, 0x10412, 0x10413, 0x10414, 0x10415, 0x10416, 0x10417, 0x10418, 0x10419, 0x1041a, 0x1041b, 0x1041c, 0x1041d, 0x1041e, 0x1041f, 0x10420, 0x10421, 0x10422, 0x10423, 0x10424, 0x10425, 0x10426, 0x10427, 0x104b0, 0x104b1, 0x104b2, 0x104b3, 0x104b4, 0x104b5, 0x104b6, 0x104b7, 0x104b8, 0x104b9, 0x104ba, 0x104bb, 0x104bc, 0x104bd, 0x104be, 0x104bf, 0x104c0, 0x104c1, 0x104c2, 0x104c3, 0x104c4, 0x104c5, 0x104c6, 0x104c7, 0x104c8, 0x104c9, 0x104ca, 0x104cb, 0x104cc, 0x104cd, 0x104ce, 0x104cf, 0x104d0, 0x104d1, 0x104d2, 0x104d3, 0x10570, 0x10571, 0x10572, 0x10573, 0x10574, 0x10575, 0x10576, 0x10577, 0x10578, 0x10579, 0x1057a, 0x1057c, 0x1057d, 0x1057e, 0x1057f, 0x10580, 0x10581, 0x10582, 0x10583, 0x10584, 0x10585, 0x10586, 0x10587, 0x10588, 0x10589, 0x1058a, 0x1058c, 0x1058d, 0x1058e, 0x1058f, 0x10590, 0x10591, 0x10592, 0x10594, 0x10595, 0x10c80, 0x10c81, 0x10c82, 0x10c83, 0x10c84, 0x10c85, 0x10c86, 0x10c87, 0x10c88, 0x10c89, 0x10c8a, 0x10c8b, 0x10c8c, 0x10c8d, 0x10c8e, 0x10c8f, 0x10c90, 0x10c91, 0x10c92, 0x10c93, 0x10c94, 0x10c95, 0x10c96, 0x10c97, 0x10c98, 0x10c99, 0x10c9a, 0x10c9b, 0x10c9c, 0x10c9d, 0x10c9e, 0x10c9f, 0x10ca0, 0x10ca1, 0x10ca2, 0x10ca3, 0x10ca4, 0x10ca5, 0x10ca6, 0x10ca7, 0x10ca8, 0x10ca9, 0x10caa, 0x10cab, 0x10cac, 0x10cad, 0x10cae, 0x10caf, 0x10cb0, 0x10cb1, 0x10cb2, 0x118a0, 0x118a1, 0x118a2, 0x118a3, 0x118a4, 0x118a5, 0x118a6, 0x118a7, 0x118a8, 0x118a9, 0x118aa, 0x118ab, 0x118ac, 0x118ad, 0x118ae, 0x118af, 0x118b0, 0x118b1, 0x118b2, 0x118b3, 0x118b4, 0x118b5, 0x118b6, 0x118b7, 0x118b8, 0x118b9, 0x118ba, 0x118bb, 0x118bc, 0x118bd, 0x118be, 0x118bf, 0x16e40, 0x16e41, 0x16e42, 0x16e43, 0x16e44, 0x16e45, 0x16e46, 0x16e47, 0x16e48, 0x16e49, 0x16e4a, 0x16e4b, 0x16e4c, 0x16e4d, 0x16e4e, 0x16e4f, 0x16e50, 0x16e51, 0x16e52, 0x16e53, 0x16e54, 0x16e55, 0x16e56, 0x16e57, 0x16e58, 0x16e59, 0x16e5a, 0x16e5b, 0x16e5c, 0x16e5d, 0x16e5e, 0x16e5f, 0x1e900, 0x1e901, 0x1e902, 0x1e903, 0x1e904, 0x1e905, 0x1e906, 0x1e907, 0x1e908, 0x1e909, 0x1e90a, 0x1e90b, 0x1e90c, 0x1e90d, 0x1e90e, 0x1e90f, 0x1e910, 0x1e911, 0x1e912, 0x1e913, 0x1e914, 0x1e915, 0x1e916, 0x1e917, 0x1e918, 0x1e919, 0x1e91a, 0x1e91b, 0x1e91c, 0x1e91d, 0x1e91e, 0x1e91f, 0x1e920, 0x1e921} +var _unicodeCaseFoldingTo = [...]rune{97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 956, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 248, 249, 250, 251, 252, 253, 254, 115, 115, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 105, 775, 307, 309, 311, 314, 316, 318, 320, 322, 324, 326, 328, 700, 110, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 255, 378, 380, 382, 115, 595, 387, 389, 596, 392, 598, 599, 396, 477, 601, 603, 402, 608, 611, 617, 616, 409, 623, 626, 629, 417, 419, 421, 640, 424, 643, 429, 648, 432, 650, 651, 436, 438, 658, 441, 445, 454, 454, 457, 457, 460, 460, 462, 464, 466, 468, 470, 472, 474, 476, 479, 481, 483, 485, 487, 489, 491, 493, 495, 106, 780, 499, 499, 501, 405, 447, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 414, 547, 549, 551, 553, 555, 557, 559, 561, 563, 11365, 572, 410, 11366, 578, 384, 649, 652, 583, 585, 587, 589, 591, 953, 881, 883, 887, 1011, 940, 941, 942, 943, 972, 973, 974, 953, 776, 769, 945, 946, 947, 948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958, 959, 960, 961, 963, 964, 965, 966, 967, 968, 969, 970, 971, 965, 776, 769, 963, 983, 946, 952, 966, 960, 985, 987, 989, 991, 993, 995, 997, 999, 1001, 1003, 1005, 1007, 954, 961, 952, 949, 1016, 1010, 1019, 891, 892, 893, 1104, 1105, 1106, 1107, 1108, 1109, 1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1072, 1073, 1074, 1075, 1076, 1077, 1078, 1079, 1080, 1081, 1082, 1083, 1084, 1085, 1086, 1087, 1088, 1089, 1090, 1091, 1092, 1093, 1094, 1095, 1096, 1097, 1098, 1099, 1100, 1101, 1102, 1103, 1121, 1123, 1125, 1127, 1129, 1131, 1133, 1135, 1137, 1139, 1141, 1143, 1145, 1147, 1149, 1151, 1153, 1163, 1165, 1167, 1169, 1171, 1173, 1175, 1177, 1179, 1181, 1183, 1185, 1187, 1189, 1191, 1193, 1195, 1197, 1199, 1201, 1203, 1205, 1207, 1209, 1211, 1213, 1215, 1231, 1218, 1220, 1222, 1224, 1226, 1228, 1230, 1233, 1235, 1237, 1239, 1241, 1243, 1245, 1247, 1249, 1251, 1253, 1255, 1257, 1259, 1261, 1263, 1265, 1267, 1269, 1271, 1273, 1275, 1277, 1279, 1281, 1283, 1285, 1287, 1289, 1291, 1293, 1295, 1297, 1299, 1301, 1303, 1305, 1307, 1309, 1311, 1313, 1315, 1317, 1319, 1321, 1323, 1325, 1327, 1377, 1378, 1379, 1380, 1381, 1382, 1383, 1384, 1385, 1386, 1387, 1388, 1389, 1390, 1391, 1392, 1393, 1394, 1395, 1396, 1397, 1398, 1399, 1400, 1401, 1402, 1403, 1404, 1405, 1406, 1407, 1408, 1409, 1410, 1411, 1412, 1413, 1414, 1381, 1410, 11520, 11521, 11522, 11523, 11524, 11525, 11526, 11527, 11528, 11529, 11530, 11531, 11532, 11533, 11534, 11535, 11536, 11537, 11538, 11539, 11540, 11541, 11542, 11543, 11544, 11545, 11546, 11547, 11548, 11549, 11550, 11551, 11552, 11553, 11554, 11555, 11556, 11557, 11559, 11565, 5104, 5105, 5106, 5107, 5108, 5109, 1074, 1076, 1086, 1089, 1090, 1090, 1098, 1123, 42571, 4304, 4305, 4306, 4307, 4308, 4309, 4310, 4311, 4312, 4313, 4314, 4315, 4316, 4317, 4318, 4319, 4320, 4321, 4322, 4323, 4324, 4325, 4326, 4327, 4328, 4329, 4330, 4331, 4332, 4333, 4334, 4335, 4336, 4337, 4338, 4339, 4340, 4341, 4342, 4343, 4344, 4345, 4346, 4349, 4350, 4351, 7681, 7683, 7685, 7687, 7689, 7691, 7693, 7695, 7697, 7699, 7701, 7703, 7705, 7707, 7709, 7711, 7713, 7715, 7717, 7719, 7721, 7723, 7725, 7727, 7729, 7731, 7733, 7735, 7737, 7739, 7741, 7743, 7745, 7747, 7749, 7751, 7753, 7755, 7757, 7759, 7761, 7763, 7765, 7767, 7769, 7771, 7773, 7775, 7777, 7779, 7781, 7783, 7785, 7787, 7789, 7791, 7793, 7795, 7797, 7799, 7801, 7803, 7805, 7807, 7809, 7811, 7813, 7815, 7817, 7819, 7821, 7823, 7825, 7827, 7829, 104, 817, 116, 776, 119, 778, 121, 778, 97, 702, 7777, 115, 115, 7841, 7843, 7845, 7847, 7849, 7851, 7853, 7855, 7857, 7859, 7861, 7863, 7865, 7867, 7869, 7871, 7873, 7875, 7877, 7879, 7881, 7883, 7885, 7887, 7889, 7891, 7893, 7895, 7897, 7899, 7901, 7903, 7905, 7907, 7909, 7911, 7913, 7915, 7917, 7919, 7921, 7923, 7925, 7927, 7929, 7931, 7933, 7935, 7936, 7937, 7938, 7939, 7940, 7941, 7942, 7943, 7952, 7953, 7954, 7955, 7956, 7957, 7968, 7969, 7970, 7971, 7972, 7973, 7974, 7975, 7984, 7985, 7986, 7987, 7988, 7989, 7990, 7991, 8000, 8001, 8002, 8003, 8004, 8005, 965, 787, 965, 787, 768, 965, 787, 769, 965, 787, 834, 8017, 8019, 8021, 8023, 8032, 8033, 8034, 8035, 8036, 8037, 8038, 8039, 7936, 953, 7937, 953, 7938, 953, 7939, 953, 7940, 953, 7941, 953, 7942, 953, 7943, 953, 7936, 953, 7937, 953, 7938, 953, 7939, 953, 7940, 953, 7941, 953, 7942, 953, 7943, 953, 7968, 953, 7969, 953, 7970, 953, 7971, 953, 7972, 953, 7973, 953, 7974, 953, 7975, 953, 7968, 953, 7969, 953, 7970, 953, 7971, 953, 7972, 953, 7973, 953, 7974, 953, 7975, 953, 8032, 953, 8033, 953, 8034, 953, 8035, 953, 8036, 953, 8037, 953, 8038, 953, 8039, 953, 8032, 953, 8033, 953, 8034, 953, 8035, 953, 8036, 953, 8037, 953, 8038, 953, 8039, 953, 8048, 953, 945, 953, 940, 953, 945, 834, 945, 834, 953, 8112, 8113, 8048, 8049, 945, 953, 953, 8052, 953, 951, 953, 942, 953, 951, 834, 951, 834, 953, 8050, 8051, 8052, 8053, 951, 953, 953, 776, 768, 953, 776, 769, 953, 834, 953, 776, 834, 8144, 8145, 8054, 8055, 965, 776, 768, 965, 776, 769, 961, 787, 965, 834, 965, 776, 834, 8160, 8161, 8058, 8059, 8165, 8060, 953, 969, 953, 974, 953, 969, 834, 969, 834, 953, 8056, 8057, 8060, 8061, 969, 953, 969, 107, 229, 8526, 8560, 8561, 8562, 8563, 8564, 8565, 8566, 8567, 8568, 8569, 8570, 8571, 8572, 8573, 8574, 8575, 8580, 9424, 9425, 9426, 9427, 9428, 9429, 9430, 9431, 9432, 9433, 9434, 9435, 9436, 9437, 9438, 9439, 9440, 9441, 9442, 9443, 9444, 9445, 9446, 9447, 9448, 9449, 11312, 11313, 11314, 11315, 11316, 11317, 11318, 11319, 11320, 11321, 11322, 11323, 11324, 11325, 11326, 11327, 11328, 11329, 11330, 11331, 11332, 11333, 11334, 11335, 11336, 11337, 11338, 11339, 11340, 11341, 11342, 11343, 11344, 11345, 11346, 11347, 11348, 11349, 11350, 11351, 11352, 11353, 11354, 11355, 11356, 11357, 11358, 11359, 11361, 619, 7549, 637, 11368, 11370, 11372, 593, 625, 592, 594, 11379, 11382, 575, 576, 11393, 11395, 11397, 11399, 11401, 11403, 11405, 11407, 11409, 11411, 11413, 11415, 11417, 11419, 11421, 11423, 11425, 11427, 11429, 11431, 11433, 11435, 11437, 11439, 11441, 11443, 11445, 11447, 11449, 11451, 11453, 11455, 11457, 11459, 11461, 11463, 11465, 11467, 11469, 11471, 11473, 11475, 11477, 11479, 11481, 11483, 11485, 11487, 11489, 11491, 11500, 11502, 11507, 42561, 42563, 42565, 42567, 42569, 42571, 42573, 42575, 42577, 42579, 42581, 42583, 42585, 42587, 42589, 42591, 42593, 42595, 42597, 42599, 42601, 42603, 42605, 42625, 42627, 42629, 42631, 42633, 42635, 42637, 42639, 42641, 42643, 42645, 42647, 42649, 42651, 42787, 42789, 42791, 42793, 42795, 42797, 42799, 42803, 42805, 42807, 42809, 42811, 42813, 42815, 42817, 42819, 42821, 42823, 42825, 42827, 42829, 42831, 42833, 42835, 42837, 42839, 42841, 42843, 42845, 42847, 42849, 42851, 42853, 42855, 42857, 42859, 42861, 42863, 42874, 42876, 7545, 42879, 42881, 42883, 42885, 42887, 42892, 613, 42897, 42899, 42903, 42905, 42907, 42909, 42911, 42913, 42915, 42917, 42919, 42921, 614, 604, 609, 620, 618, 670, 647, 669, 43859, 42933, 42935, 42937, 42939, 42941, 42943, 42945, 42947, 42900, 642, 7566, 42952, 42954, 42961, 42967, 42969, 42998, 5024, 5025, 5026, 5027, 5028, 5029, 5030, 5031, 5032, 5033, 5034, 5035, 5036, 5037, 5038, 5039, 5040, 5041, 5042, 5043, 5044, 5045, 5046, 5047, 5048, 5049, 5050, 5051, 5052, 5053, 5054, 5055, 5056, 5057, 5058, 5059, 5060, 5061, 5062, 5063, 5064, 5065, 5066, 5067, 5068, 5069, 5070, 5071, 5072, 5073, 5074, 5075, 5076, 5077, 5078, 5079, 5080, 5081, 5082, 5083, 5084, 5085, 5086, 5087, 5088, 5089, 5090, 5091, 5092, 5093, 5094, 5095, 5096, 5097, 5098, 5099, 5100, 5101, 5102, 5103, 102, 102, 102, 105, 102, 108, 102, 102, 105, 102, 102, 108, 115, 116, 115, 116, 1396, 1398, 1396, 1381, 1396, 1387, 1406, 1398, 1396, 1389, 65345, 65346, 65347, 65348, 65349, 65350, 65351, 65352, 65353, 65354, 65355, 65356, 65357, 65358, 65359, 65360, 65361, 65362, 65363, 65364, 65365, 65366, 65367, 65368, 65369, 65370, 66600, 66601, 66602, 66603, 66604, 66605, 66606, 66607, 66608, 66609, 66610, 66611, 66612, 66613, 66614, 66615, 66616, 66617, 66618, 66619, 66620, 66621, 66622, 66623, 66624, 66625, 66626, 66627, 66628, 66629, 66630, 66631, 66632, 66633, 66634, 66635, 66636, 66637, 66638, 66639, 66776, 66777, 66778, 66779, 66780, 66781, 66782, 66783, 66784, 66785, 66786, 66787, 66788, 66789, 66790, 66791, 66792, 66793, 66794, 66795, 66796, 66797, 66798, 66799, 66800, 66801, 66802, 66803, 66804, 66805, 66806, 66807, 66808, 66809, 66810, 66811, 66967, 66968, 66969, 66970, 66971, 66972, 66973, 66974, 66975, 66976, 66977, 66979, 66980, 66981, 66982, 66983, 66984, 66985, 66986, 66987, 66988, 66989, 66990, 66991, 66992, 66993, 66995, 66996, 66997, 66998, 66999, 67000, 67001, 67003, 67004, 68800, 68801, 68802, 68803, 68804, 68805, 68806, 68807, 68808, 68809, 68810, 68811, 68812, 68813, 68814, 68815, 68816, 68817, 68818, 68819, 68820, 68821, 68822, 68823, 68824, 68825, 68826, 68827, 68828, 68829, 68830, 68831, 68832, 68833, 68834, 68835, 68836, 68837, 68838, 68839, 68840, 68841, 68842, 68843, 68844, 68845, 68846, 68847, 68848, 68849, 68850, 71872, 71873, 71874, 71875, 71876, 71877, 71878, 71879, 71880, 71881, 71882, 71883, 71884, 71885, 71886, 71887, 71888, 71889, 71890, 71891, 71892, 71893, 71894, 71895, 71896, 71897, 71898, 71899, 71900, 71901, 71902, 71903, 93792, 93793, 93794, 93795, 93796, 93797, 93798, 93799, 93800, 93801, 93802, 93803, 93804, 93805, 93806, 93807, 93808, 93809, 93810, 93811, 93812, 93813, 93814, 93815, 93816, 93817, 93818, 93819, 93820, 93821, 93822, 93823, 125218, 125219, 125220, 125221, 125222, 125223, 125224, 125225, 125226, 125227, 125228, 125229, 125230, 125231, 125232, 125233, 125234, 125235, 125236, 125237, 125238, 125239, 125240, 125241, 125242, 125243, 125244, 125245, 125246, 125247, 125248, 125249, 125250, 125251} +var _unicodeCaseFoldingToIndex = "\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x03\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x03\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x02\x02\x02\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x03\x03\x03\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x02\x03\x01\x01\x01\x01\x02\x01\x02\x02\x02\x02\x03\x01\x01\x01\x01\x02\x03\x03\x02\x03\x01\x01\x01\x01\x03\x03\x02\x02\x03\x01\x01\x01\x01\x01\x02\x02\x02\x02\x03\x01\x01\x01\x01\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x02\x02\x02\x03\x03\x02\x02\x02\x02\x02\x02\x02\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01\x01" diff --git a/util/unicode_case_folding.go b/util/unicode_case_folding.go new file mode 100644 index 0000000..ecc7e11 --- /dev/null +++ b/util/unicode_case_folding.go @@ -0,0 +1,17 @@ +package util + +//go:generate go run ../_tools unicode-case-folding-map -o ../_tools/unicode-case-folding-map.json +//go:generate go run ../_tools emb-structs -i ../_tools/unicode-case-folding-map.json -o ./unicode_case_folding.gen.go + +var unicodeCaseFoldings map[rune][]rune + +func init() { + unicodeCaseFoldings = make(map[rune][]rune, _unicodeCaseFoldingLength) + cTo := 0 + for i := range _unicodeCaseFoldingLength { + tTo := cTo + int(_unicodeCaseFoldingToIndex[i]) + to := _unicodeCaseFoldingTo[cTo:tTo] + unicodeCaseFoldings[_unicodeCaseFoldingFrom[i]] = to + cTo = tTo + } +} diff --git a/util/util.go b/util/util.go new file mode 100644 index 0000000..68a84bf --- /dev/null +++ b/util/util.go @@ -0,0 +1,1044 @@ +// Package util provides utility functions for the goldmark. +package util + +import ( + "bytes" + "io" + "net/url" + "regexp" + "slices" + "sort" + "strconv" + "unicode" + "unicode/utf8" +) + +// A CopyOnWriteBuffer is a byte buffer that copies buffer when +// it need to be changed. +type CopyOnWriteBuffer struct { + buffer []byte + copied bool +} + +// NewCopyOnWriteBuffer returns a new CopyOnWriteBuffer. +func NewCopyOnWriteBuffer(buffer []byte) CopyOnWriteBuffer { + return CopyOnWriteBuffer{ + buffer: buffer, + copied: false, + } +} + +// Write writes given bytes to the buffer. +// Write allocate new buffer and clears it at the first time. +func (b *CopyOnWriteBuffer) Write(value []byte) { + if !b.copied { + b.buffer = make([]byte, 0, len(b.buffer)+20) + b.copied = true + } + b.buffer = append(b.buffer, value...) +} + +// WriteString writes given string to the buffer. +// WriteString allocate new buffer and clears it at the first time. +func (b *CopyOnWriteBuffer) WriteString(value string) { + b.Write(StringToReadOnlyBytes(value)) +} + +// Append appends given bytes to the buffer. +// Append copy buffer at the first time. +func (b *CopyOnWriteBuffer) Append(value []byte) { + if !b.copied { + tmp := make([]byte, len(b.buffer), len(b.buffer)+20) + copy(tmp, b.buffer) + b.buffer = tmp + b.copied = true + } + b.buffer = append(b.buffer, value...) +} + +// AppendString appends given string to the buffer. +// AppendString copy buffer at the first time. +func (b *CopyOnWriteBuffer) AppendString(value string) { + b.Append(StringToReadOnlyBytes(value)) +} + +// WriteByte writes the given byte to the buffer. +// WriteByte allocate new buffer and clears it at the first time. +func (b *CopyOnWriteBuffer) WriteByte(c byte) error { + if !b.copied { + b.buffer = make([]byte, 0, len(b.buffer)+20) + b.copied = true + } + b.buffer = append(b.buffer, c) + return nil +} + +// AppendByte appends given bytes to the buffer. +// AppendByte copy buffer at the first time. +func (b *CopyOnWriteBuffer) AppendByte(c byte) { + if !b.copied { + tmp := make([]byte, len(b.buffer), len(b.buffer)+20) + copy(tmp, b.buffer) + b.buffer = tmp + b.copied = true + } + b.buffer = append(b.buffer, c) +} + +// Bytes returns bytes of this buffer. +func (b *CopyOnWriteBuffer) Bytes() []byte { + return b.buffer +} + +// IsCopied returns true if buffer has been copied, otherwise false. +func (b *CopyOnWriteBuffer) IsCopied() bool { + return b.copied +} + +// IsEscapedPunctuation returns true if character at a given index i +// is an escaped punctuation, otherwise false. +func IsEscapedPunctuation(source []byte, i int) bool { + return source[i] == '\\' && i < len(source)-1 && IsPunct(source[i+1]) +} + +// ReadWhile read the given source while pred is true. +func ReadWhile(source []byte, index [2]int, pred func(byte) bool) (int, bool) { + j := index[0] + ok := false + for ; j < index[1]; j++ { + c1 := source[j] + if pred(c1) { + ok = true + continue + } + break + } + return j, ok +} + +// IsBlank returns true if the given string is all space characters. +func IsBlank(bs []byte) bool { + for _, b := range bs { + if !IsSpace(b) { + return false + } + } + return true +} + +// VisualizeSpaces visualize invisible space characters. +func VisualizeSpaces(bs []byte) []byte { + bs = bytes.ReplaceAll(bs, []byte(" "), []byte("[SPACE]")) + bs = bytes.ReplaceAll(bs, []byte("\t"), []byte("[TAB]")) + bs = bytes.ReplaceAll(bs, []byte("\n"), []byte("[NEWLINE]\n")) + bs = bytes.ReplaceAll(bs, []byte("\r"), []byte("[CR]")) + bs = bytes.ReplaceAll(bs, []byte("\v"), []byte("[VTAB]")) + bs = bytes.ReplaceAll(bs, []byte("\x00"), []byte("[NUL]")) + bs = bytes.ReplaceAll(bs, []byte("\ufffd"), []byte("[U+FFFD]")) + return bs +} + +// TabWidth calculates actual width of a tab at the given position. +func TabWidth(currentPos int) int { + return 4 - currentPos%4 +} + +// IndentPosition searches an indent position with the given width for the given line. +// If the line contains tab characters, paddings may be not zero. +// currentPos==0 and width==2: +// +// position: 0 1 +// [TAB]aaaa +// width: 1234 5678 +// +// width=2 is in the tab character. In this case, IndentPosition returns +// (pos=1, padding=2). +func IndentPosition(bs []byte, currentPos, width int) (pos, padding int) { + return IndentPositionPadding(bs, currentPos, 0, width) +} + +// IndentPositionPadding searches an indent position with the given width for the given line. +// This function is mostly same as IndentPosition except this function +// takes account into additional paddings. +func IndentPositionPadding(bs []byte, currentPos, paddingv, width int) (pos, padding int) { + if width == 0 { + return 0, paddingv + } + w := 0 + i := 0 + l := len(bs) + p := paddingv + for ; i < l; i++ { + if p > 0 { + p-- + w++ + continue + } + if bs[i] == '\t' && w < width { + w += TabWidth(currentPos + w) + } else if bs[i] == ' ' && w < width { + w++ + } else { + break + } + } + if w >= width { + return i - paddingv, w - width + } + return -1, -1 +} + +// DedentPosition dedents lines by the given width. +// +// Deprecated: This function has bugs. Use util.IndentPositionPadding and util.FirstNonSpacePosition. +func DedentPosition(bs []byte, currentPos, width int) (pos, padding int) { + if width == 0 { + return 0, 0 + } + w := 0 + l := len(bs) + i := 0 +loop: + for ; i < l; i++ { + switch bs[i] { + case '\t': + w += TabWidth(currentPos + w) + case ' ': + w++ + default: + break loop + } + } + if w >= width { + return i, w - width + } + return i, 0 +} + +// DedentPositionPadding dedents lines by the given width. +// This function is mostly same as DedentPosition except this function +// takes account into additional paddings. +// +// Deprecated: This function has bugs. Use util.IndentPositionPadding and util.FirstNonSpacePosition. +func DedentPositionPadding(bs []byte, currentPos, paddingv, width int) (pos, padding int) { + if width == 0 { + return 0, paddingv + } + + w := 0 + i := 0 + l := len(bs) +loop: + for ; i < l; i++ { + switch bs[i] { + case '\t': + w += TabWidth(currentPos + w) + case ' ': + w++ + default: + break loop + } + } + if w >= width { + return i - paddingv, w - width + } + return i - paddingv, 0 +} + +// IndentWidth calculate an indent width for the given line. +func IndentWidth(bs []byte, currentPos int) (width, pos int) { + for i := range len(bs) { + switch bs[i] { + case ' ': + width++ + pos++ + case '\t': + width += TabWidth(currentPos + width) + pos++ + default: + return + } + } + return +} + +// FirstNonSpacePosition returns a position line that is a first nonspace +// character. +func FirstNonSpacePosition(bs []byte) int { + i := 0 + for ; i < len(bs); i++ { + c := bs[i] + if c == ' ' || c == '\t' { + continue + } + if c == '\n' { + return -1 + } + return i + } + return -1 +} + +// FindClosure returns a position that closes the given opener. +// If codeSpan is set true, it ignores characters in code spans. +// If allowNesting is set true, closures correspond to nested opener will be +// ignored. +// +// Deprecated: This function can not handle newlines. Many elements +// can be existed over multiple lines(e.g. link labels). +// Use text.Reader.FindClosure. +func FindClosure(bs []byte, opener, closure byte, codeSpan, allowNesting bool) int { + i := 0 + opened := 1 + codeSpanOpener := 0 + for i < len(bs) { + c := bs[i] + if codeSpan && codeSpanOpener != 0 && c == '`' { + codeSpanCloser := 0 + for ; i < len(bs); i++ { + if bs[i] == '`' { + codeSpanCloser++ + } else { + i-- + break + } + } + if codeSpanCloser == codeSpanOpener { + codeSpanOpener = 0 + } + } else if codeSpanOpener == 0 && c == '\\' && i < len(bs)-1 && IsPunct(bs[i+1]) { + i += 2 + continue + } else if codeSpan && codeSpanOpener == 0 && c == '`' { + for ; i < len(bs); i++ { + if bs[i] == '`' { + codeSpanOpener++ + } else { + i-- + break + } + } + } else if (codeSpan && codeSpanOpener == 0) || !codeSpan { + switch c { + case closure: + opened-- + if opened == 0 { + return i + } + case opener: + if !allowNesting { + return -1 + } + opened++ + } + } + i++ + } + return -1 +} + +// TrimLeft trims characters in the given s from head of the source. +// bytes.TrimLeft offers same functionalities, but bytes.TrimLeft +// allocates new buffer for the result. +func TrimLeft(source, b []byte) []byte { + i := 0 + for ; i < len(source); i++ { + c := source[i] + found := false + for j := range len(b) { + if c == b[j] { + found = true + break + } + } + if !found { + break + } + } + return source[i:] +} + +// TrimRight trims characters in the given s from tail of the source. +func TrimRight(source, b []byte) []byte { + i := len(source) - 1 + for ; i >= 0; i-- { + c := source[i] + found := false + for j := range len(b) { + if c == b[j] { + found = true + break + } + } + if !found { + break + } + } + return source[:i+1] +} + +// TrimLeftLength returns a length of leading specified characters. +func TrimLeftLength(source, s []byte) int { + return len(source) - len(TrimLeft(source, s)) +} + +// TrimRightLength returns a length of trailing specified characters. +func TrimRightLength(source, s []byte) int { + return len(source) - len(TrimRight(source, s)) +} + +// TrimLeftSpaceLength returns a length of leading space characters. +func TrimLeftSpaceLength(source []byte) int { + i := 0 + for ; i < len(source); i++ { + if !IsSpace(source[i]) { + break + } + } + return i +} + +// TrimRightSpaceLength returns a length of trailing space characters. +func TrimRightSpaceLength(source []byte) int { + l := len(source) + i := l - 1 + for ; i >= 0; i-- { + if !IsSpace(source[i]) { + break + } + } + if i < 0 { + return l + } + return l - 1 - i +} + +// TrimLeftSpace returns a subslice of the given string by slicing off all leading +// space characters. +func TrimLeftSpace(source []byte) []byte { + return TrimLeft(source, spaces) +} + +// TrimRightSpace returns a subslice of the given string by slicing off all trailing +// space characters. +func TrimRightSpace(source []byte) []byte { + return TrimRight(source, spaces) +} + +// DoFullUnicodeCaseFolding performs full unicode case folding to given bytes. +func DoFullUnicodeCaseFolding(v []byte) []byte { + var rbuf []byte + cob := NewCopyOnWriteBuffer(v) + n := 0 + for i := 0; i < len(v); i++ { + c := v[i] + if c < 0xb5 { + if c >= 0x41 && c <= 0x5a { + // A-Z to a-z + cob.Write(v[n:i]) + _ = cob.WriteByte(c + 32) + n = i + 1 + } + continue + } + + if !utf8.RuneStart(c) { + continue + } + r, length := utf8.DecodeRune(v[i:]) + if r == utf8.RuneError { + continue + } + folded, ok := unicodeCaseFoldings[r] + if !ok { + continue + } + + cob.Write(v[n:i]) + if rbuf == nil { + rbuf = make([]byte, 4) + } + for _, f := range folded { + l := utf8.EncodeRune(rbuf, f) + cob.Write(rbuf[:l]) + } + i += length - 1 + n = i + 1 + } + if cob.IsCopied() { + cob.Write(v[n:]) + } + return cob.Bytes() +} + +// ReplaceSpaces replaces sequence of spaces with the given repl. +func ReplaceSpaces(source []byte, repl byte) []byte { + var ret []byte + start := -1 + for i, c := range source { + iss := IsSpace(c) + if start < 0 && iss { + start = i + continue + } else if start >= 0 && iss { + continue + } else if start >= 0 { + if ret == nil { + ret = make([]byte, 0, len(source)) + ret = append(ret, source[:start]...) + } + ret = append(ret, repl) + start = -1 + } + if ret != nil { + ret = append(ret, c) + } + } + if start >= 0 && ret != nil { + ret = append(ret, repl) + } + if ret == nil { + return source + } + return ret +} + +// ToRune decode given bytes start at pos and returns a rune. +func ToRune(source []byte, pos int) rune { + i := pos + for ; i >= 0; i-- { + if utf8.RuneStart(source[i]) { + break + } + } + r, _ := utf8.DecodeRune(source[i:]) + return r +} + +// ToValidRune returns 0xFFFD if the given rune is invalid, otherwise v. +func ToValidRune(v rune) rune { + if v == 0 || !utf8.ValidRune(v) { + return rune(0xFFFD) + } + return v +} + +// ToLinkReference converts given bytes into a valid link reference string. +// ToLinkReference performs unicode case folding, trims leading and trailing spaces, converts into lower +// case and replace spaces with a single space character. +func ToLinkReference(v []byte) string { + v = TrimLeftSpace(v) + v = TrimRightSpace(v) + v = DoFullUnicodeCaseFolding(v) + return string(ReplaceSpaces(v, ' ')) +} + +var htmlQuote = []byte(""") +var htmlAmp = []byte("&") +var htmlLess = []byte("<") +var htmlGreater = []byte(">") +var htmlNull = []byte("\ufffd") + +var htmlEscapeTable = [256]*[]byte{&htmlNull, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, &htmlQuote, nil, nil, nil, &htmlAmp, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, &htmlLess, nil, &htmlGreater, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil, nil} //nolint:golint,lll + +// EscapeHTMLByte returns HTML escaped bytes if the given byte should be escaped, +// otherwise nil. +func EscapeHTMLByte(b byte) []byte { + v := htmlEscapeTable[b] + if v != nil { + return *v + } + return nil +} + +// EscapeHTML escapes characters that should be escaped in HTML text. +func EscapeHTML(v []byte) []byte { + cob := NewCopyOnWriteBuffer(v) + n := 0 + for i := range len(v) { + c := v[i] + escaped := htmlEscapeTable[c] + if escaped != nil { + cob.Write(v[n:i]) + cob.Write(*escaped) + n = i + 1 + } + } + if cob.IsCopied() { + cob.Write(v[n:]) + } + return cob.Bytes() +} + +// UnescapePunctuations unescapes blackslash escaped punctuations. +func UnescapePunctuations(source []byte) []byte { + cob := NewCopyOnWriteBuffer(source) + limit := len(source) + n := 0 + for i := 0; i < limit; { + c := source[i] + if i < limit-1 && c == '\\' && IsPunct(source[i+1]) { + cob.Write(source[n:i]) + _ = cob.WriteByte(source[i+1]) + i += 2 + n = i + continue + } + i++ + } + if cob.IsCopied() { + cob.Write(source[n:]) + } + return cob.Bytes() +} + +// ResolveNumericReferences resolve numeric references like 'Ӓ" . +func ResolveNumericReferences(source []byte) []byte { + cob := NewCopyOnWriteBuffer(source) + buf := make([]byte, 6) + limit := len(source) + var ok bool + n := 0 + for i := 0; i < limit; i++ { + if source[i] == '&' { + pos := i + next := i + 1 + if next < limit && source[next] == '#' { + nnext := next + 1 + if nnext < limit { + nc := source[nnext] + // code point like #x22; + if nnext < limit && nc == 'x' || nc == 'X' { + start := nnext + 1 + i, ok = ReadWhile(source, [2]int{start, limit}, IsHexDecimal) + if ok && i < limit && source[i] == ';' { + v, _ := strconv.ParseUint(BytesToReadOnlyString(source[start:i]), 16, 32) + cob.Write(source[n:pos]) + n = i + 1 + runeSize := utf8.EncodeRune(buf, ToValidRune(rune(v))) + cob.Write(buf[:runeSize]) + continue + } + // code point like #1234; + } else if nc >= '0' && nc <= '9' { + start := nnext + i, ok = ReadWhile(source, [2]int{start, limit}, IsNumeric) + if ok && i < limit && i-start < 8 && source[i] == ';' { + v, _ := strconv.ParseUint(BytesToReadOnlyString(source[start:i]), 0, 32) + cob.Write(source[n:pos]) + n = i + 1 + runeSize := utf8.EncodeRune(buf, ToValidRune(rune(v))) + cob.Write(buf[:runeSize]) + continue + } + } + } + } + i = next - 1 + } + } + if cob.IsCopied() { + cob.Write(source[n:]) + } + return cob.Bytes() +} + +// ResolveEntityNames resolve entity references like 'ö" . +func ResolveEntityNames(source []byte) []byte { + cob := NewCopyOnWriteBuffer(source) + limit := len(source) + var ok bool + n := 0 + for i := 0; i < limit; i++ { + if source[i] == '&' { + pos := i + next := i + 1 + if !(next < limit && source[next] == '#') { + start := next + i, ok = ReadWhile(source, [2]int{start, limit}, IsAlphaNumeric) + if ok && i < limit && source[i] == ';' { + name := BytesToReadOnlyString(source[start:i]) + entity, ok := LookUpHTML5EntityByName(name) + if ok { + cob.Write(source[n:pos]) + n = i + 1 + cob.Write(entity.Characters) + continue + } + } + } + i = next - 1 + } + } + if cob.IsCopied() { + cob.Write(source[n:]) + } + return cob.Bytes() +} + +var htmlSpace = []byte("%20") + +// URLEscape escape the given URL. +// If resolveReference is set true: +// 1. unescape punctuations +// 2. resolve numeric references +// 3. resolve entity references +// +// URL encoded values (%xx) are kept as is. +func URLEscape(v []byte, resolveReference bool) []byte { + if resolveReference { + v = UnescapePunctuations(v) + v = ResolveNumericReferences(v) + v = ResolveEntityNames(v) + } + cob := NewCopyOnWriteBuffer(v) + limit := len(v) + n := 0 + + for i := 0; i < limit; { + c := v[i] + if urlEscapeTable[c] == 1 { + i++ + continue + } + if c == '%' && i+2 < limit && IsHexDecimal(v[i+1]) && IsHexDecimal(v[i+1]) { + i += 3 + continue + } + u8len := utf8lenTable[c] + if u8len == 99 { // invalid utf8 leading byte, skip it + i++ + continue + } + if c == ' ' { + cob.Write(v[n:i]) + cob.Write(htmlSpace) + i++ + n = i + continue + } + if int(u8len) > len(v) { + u8len = int8(len(v) - 1) + } + if u8len == 0 { + i++ + n = i + continue + } + cob.Write(v[n:i]) + stop := i + int(u8len) + if stop > len(v) { + i++ + n = i + continue + } + cob.Write(StringToReadOnlyBytes(url.QueryEscape(string(v[i:stop])))) + i += int(u8len) + n = i + } + if cob.IsCopied() && n < limit { + cob.Write(v[n:]) + } + return cob.Bytes() +} + +// FindURLIndex returns a stop index value if the given bytes seem an URL. +// This function is equivalent to [A-Za-z][A-Za-z0-9.+-]{1,31}:[^<>\x00-\x20]* . +func FindURLIndex(b []byte) int { + i := 0 + if !(len(b) > 0 && urlTable[b[i]]&7 == 7) { + return -1 + } + i++ + for ; i < len(b); i++ { + c := b[i] + if urlTable[c]&4 != 4 { + break + } + } + if i == 1 || i > 33 || i >= len(b) { + return -1 + } + if b[i] != ':' { + return -1 + } + i++ + for ; i < len(b); i++ { + c := b[i] + if urlTable[c]&1 != 1 { + break + } + } + return i +} + +var emailDomainRegexp = regexp.MustCompile(`^[a-zA-Z0-9](?:[a-zA-Z0-9-]{0,61}[a-zA-Z0-9])?(?:\.[a-zA-Z0-9](?:[a-zA-Z0-9-]{0,61}[a-zA-Z0-9])?)*`) //nolint:golint,lll + +// FindEmailIndex returns a stop index value if the given bytes seem an email address. +func FindEmailIndex(b []byte) int { + // TODO: eliminate regexps + i := 0 + for ; i < len(b); i++ { + c := b[i] + if emailTable[c]&1 != 1 { + break + } + } + if i == 0 { + return -1 + } + if i >= len(b) || b[i] != '@' { + return -1 + } + i++ + if i >= len(b) { + return -1 + } + match := emailDomainRegexp.FindSubmatchIndex(b[i:]) + if match == nil { + return -1 + } + return i + match[1] +} + +var spaces = []byte(" \t\n\x0b\x0c\x0d") + +var spaceTable = [256]int8{0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0} //nolint:golint,lll + +var punctTable = [256]int8{0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0} //nolint:golint,lll + +// a-zA-Z0-9, ;/?:@&=+$,-_.!~*'()# + +var urlEscapeTable = [256]int8{0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 1, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 0, 0, 0, 1, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0} //nolint:golint,lll + +var utf8lenTable = [256]int8{1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 99, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 4, 4, 4, 4, 4, 4, 4, 4, 99, 99, 99, 99, 99, 99, 99, 99} //nolint:golint,lll + +var urlTable = [256]uint8{0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 5, 1, 5, 5, 1, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 1, 1, 0, 1, 0, 1, 1, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 1, 1, 1, 1, 1, 1, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 7, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1} //nolint:golint,lll + +var emailTable = [256]uint8{0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 1, 1, 1, 1, 1, 0, 0, 1, 1, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 0, 0, 1, 0, 1, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 0, 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0} //nolint:golint,lll + +// UTF8Len returns a byte length of the utf-8 character. +func UTF8Len(b byte) int8 { + return utf8lenTable[b] +} + +// IsPunct returns true if the given character is a punctuation, otherwise false. +func IsPunct(c byte) bool { + return punctTable[c] == 1 +} + +// IsPunctRune returns true if the given rune is a punctuation, otherwise false. +func IsPunctRune(r rune) bool { + return unicode.IsSymbol(r) || unicode.IsPunct(r) +} + +// IsSpace returns true if the given character is a space, otherwise false. +func IsSpace(c byte) bool { + return spaceTable[c] == 1 +} + +// IsSpaceRune returns true if the given rune is a space, otherwise false. +func IsSpaceRune(r rune) bool { + return int32(r) <= 256 && IsSpace(byte(r)) || unicode.IsSpace(r) +} + +// IsNumeric returns true if the given character is a numeric, otherwise false. +func IsNumeric(c byte) bool { + return c >= '0' && c <= '9' +} + +// IsHexDecimal returns true if the given character is a hexdecimal, otherwise false. +func IsHexDecimal(c byte) bool { + return c >= '0' && c <= '9' || c >= 'a' && c <= 'f' || c >= 'A' && c <= 'F' +} + +// IsAlphaNumeric returns true if the given character is a alphabet or a numeric, otherwise false. +func IsAlphaNumeric(c byte) bool { + return c >= 'a' && c <= 'z' || c >= 'A' && c <= 'Z' || c >= '0' && c <= '9' +} + +// A BufWriter is a subset of the bufio.Writer . +type BufWriter interface { + io.Writer + Available() int + Buffered() int + Flush() error + WriteByte(c byte) error + WriteRune(r rune) (size int, err error) + WriteString(s string) (int, error) +} + +// A PrioritizedValue struct holds pair of an arbitrary value and a priority. +type PrioritizedValue struct { + // Value is an arbitrary value that you want to prioritize. + Value any + // Priority is a priority of the value. + Priority int +} + +// PrioritizedSlice is a slice of the PrioritizedValues. +type PrioritizedSlice []PrioritizedValue + +// Sort sorts the PrioritizedSlice in ascending order. +func (s PrioritizedSlice) Sort() { + sort.Slice(s, func(i, j int) bool { + return s[i].Priority < s[j].Priority + }) +} + +// Remove removes the given value from this slice. +func (s PrioritizedSlice) Remove(v any) PrioritizedSlice { + i := 0 + found := false + for ; i < len(s); i++ { + if s[i].Value == v { + found = true + break + } + } + if !found { + return s + } + return slices.Delete(s, i, i+1) +} + +// Prioritized returns a new PrioritizedValue. +func Prioritized(v any, priority int) PrioritizedValue { + return PrioritizedValue{v, priority} +} + +func bytesHash(b []byte) uint64 { + var hash uint64 = 5381 + for _, c := range b { + hash = ((hash << 5) + hash) + uint64(c) + } + return hash +} + +// BytesFilter is a efficient data structure for checking whether bytes exist or not. +// BytesFilter is thread-safe. +type BytesFilter interface { + // Add adds given bytes to this set. + Add([]byte) + + // Contains return true if this set contains given bytes, otherwise false. + Contains([]byte) bool + + // Extend copies this filter and adds given bytes to new filter. + Extend(...[]byte) BytesFilter + + // ExtendString copies this filter and adds given bytes to new filter. + // Given string must be separated by a comma. + ExtendString(string) BytesFilter +} + +type bytesFilter struct { + chars [256]uint8 + threshold int + slots [][][]byte +} + +// NewBytesFilter returns a new BytesFilter. +func NewBytesFilter(elements ...[]byte) BytesFilter { + s := &bytesFilter{ + threshold: 3, + slots: make([][][]byte, 64), + } + for _, element := range elements { + s.Add(element) + } + return s +} + +// NewBytesFilterString returns a new BytesFilter. +// Given string must be separated by a comma. +func NewBytesFilterString(elements string) BytesFilter { + s := &bytesFilter{ + threshold: 3, + slots: make([][][]byte, 64), + } + start := 0 + for i := range len(elements) { + if elements[i] == ',' { + s.Add(StringToReadOnlyBytes(elements[start:i])) + start = i + 1 + } + } + if start < len(elements) { + s.Add(StringToReadOnlyBytes(elements[start:])) + } + return s + +} + +func (s *bytesFilter) Add(b []byte) { + l := len(b) + m := min(l, s.threshold) + for i := range m { + s.chars[b[i]] |= 1 << uint8(i) + } + h := bytesHash(b) % uint64(len(s.slots)) + slot := s.slots[h] + if slot == nil { + slot = [][]byte{} + } + s.slots[h] = append(slot, b) +} + +func (s *bytesFilter) Extend(bs ...[]byte) BytesFilter { + newFilter := NewBytesFilter().(*bytesFilter) + newFilter.chars = s.chars + newFilter.threshold = s.threshold + for k, v := range s.slots { + newSlot := make([][]byte, len(v)) + copy(newSlot, v) + newFilter.slots[k] = v + } + for _, b := range bs { + newFilter.Add(b) + } + return newFilter +} + +func (s *bytesFilter) ExtendString(elements string) BytesFilter { + newFilter := NewBytesFilter().(*bytesFilter) + newFilter.chars = s.chars + newFilter.threshold = s.threshold + for k, v := range s.slots { + newSlot := make([][]byte, len(v)) + copy(newSlot, v) + newFilter.slots[k] = v + } + start := 0 + for i := range len(elements) { + if elements[i] == ',' { + newFilter.Add(StringToReadOnlyBytes(elements[start:i])) + start = i + 1 + } + } + if start < len(elements) { + newFilter.Add(StringToReadOnlyBytes(elements[start:])) + } + return newFilter +} + +func (s *bytesFilter) Contains(b []byte) bool { + l := len(b) + m := min(l, s.threshold) + for i := range m { + if (s.chars[b[i]] & (1 << uint8(i))) == 0 { + return false + } + } + h := bytesHash(b) % uint64(len(s.slots)) + slot := s.slots[h] + if len(slot) == 0 { + return false + } + for _, element := range slot { + if bytes.Equal(element, b) { + return true + } + } + return false +} diff --git a/util/util_cjk.go b/util/util_cjk.go new file mode 100644 index 0000000..d758107 --- /dev/null +++ b/util/util_cjk.go @@ -0,0 +1,469 @@ +package util + +import "unicode" + +var cjkRadicalsSupplement = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x2E80, 0x2EFF, 1}, + }, +} + +var kangxiRadicals = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x2F00, 0x2FDF, 1}, + }, +} + +var ideographicDescriptionCharacters = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x2FF0, 0x2FFF, 1}, + }, +} + +var cjkSymbolsAndPunctuation = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x3000, 0x303F, 1}, + }, +} + +var hiragana = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x3040, 0x309F, 1}, + }, +} + +var katakana = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x30A0, 0x30FF, 1}, + }, +} + +var kanbun = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x3130, 0x318F, 1}, + {0x3190, 0x319F, 1}, + }, +} + +var cjkStrokes = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x31C0, 0x31EF, 1}, + }, +} + +var katakanaPhoneticExtensions = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x31F0, 0x31FF, 1}, + }, +} + +var cjkCompatibility = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x3300, 0x33FF, 1}, + }, +} + +var cjkUnifiedIdeographsExtensionA = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x3400, 0x4DBF, 1}, + }, +} + +var cjkUnifiedIdeographs = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0x4E00, 0x9FFF, 1}, + }, +} + +var yiSyllables = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0xA000, 0xA48F, 1}, + }, +} + +var yiRadicals = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0xA490, 0xA4CF, 1}, + }, +} + +var cjkCompatibilityIdeographs = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0xF900, 0xFAFF, 1}, + }, +} + +var verticalForms = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0xFE10, 0xFE1F, 1}, + }, +} + +var cjkCompatibilityForms = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0xFE30, 0xFE4F, 1}, + }, +} + +var smallFormVariants = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0xFE50, 0xFE6F, 1}, + }, +} + +var halfwidthAndFullwidthForms = &unicode.RangeTable{ + R16: []unicode.Range16{ + {0xFF00, 0xFFEF, 1}, + }, +} + +var kanaSupplement = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x1B000, 0x1B0FF, 1}, + }, +} + +var kanaExtendedA = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x1B100, 0x1B12F, 1}, + }, +} + +var smallKanaExtension = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x1B130, 0x1B16F, 1}, + }, +} + +var cjkUnifiedIdeographsExtensionB = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x20000, 0x2A6DF, 1}, + }, +} + +var cjkUnifiedIdeographsExtensionC = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x2A700, 0x2B73F, 1}, + }, +} + +var cjkUnifiedIdeographsExtensionD = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x2B740, 0x2B81F, 1}, + }, +} + +var cjkUnifiedIdeographsExtensionE = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x2B820, 0x2CEAF, 1}, + }, +} + +var cjkUnifiedIdeographsExtensionF = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x2CEB0, 0x2EBEF, 1}, + }, +} + +var cjkCompatibilityIdeographsSupplement = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x2F800, 0x2FA1F, 1}, + }, +} + +var cjkUnifiedIdeographsExtensionG = &unicode.RangeTable{ + R32: []unicode.Range32{ + {0x30000, 0x3134F, 1}, + }, +} + +// IsEastAsianWideRune returns trhe if the given rune is an east asian wide character, otherwise false. +func IsEastAsianWideRune(r rune) bool { + return unicode.Is(unicode.Hiragana, r) || + unicode.Is(unicode.Katakana, r) || + unicode.Is(unicode.Han, r) || + unicode.Is(unicode.Lm, r) || + unicode.Is(unicode.Hangul, r) || + unicode.Is(cjkSymbolsAndPunctuation, r) +} + +// IsSpaceDiscardingUnicodeRune returns true if the given rune is space-discarding unicode character, otherwise false. +// See https://www.w3.org/TR/2020/WD-css-text-3-20200429/#space-discard-set +func IsSpaceDiscardingUnicodeRune(r rune) bool { + return unicode.Is(cjkRadicalsSupplement, r) || + unicode.Is(kangxiRadicals, r) || + unicode.Is(ideographicDescriptionCharacters, r) || + unicode.Is(cjkSymbolsAndPunctuation, r) || + unicode.Is(hiragana, r) || + unicode.Is(katakana, r) || + unicode.Is(kanbun, r) || + unicode.Is(cjkStrokes, r) || + unicode.Is(katakanaPhoneticExtensions, r) || + unicode.Is(cjkCompatibility, r) || + unicode.Is(cjkUnifiedIdeographsExtensionA, r) || + unicode.Is(cjkUnifiedIdeographs, r) || + unicode.Is(yiSyllables, r) || + unicode.Is(yiRadicals, r) || + unicode.Is(cjkCompatibilityIdeographs, r) || + unicode.Is(verticalForms, r) || + unicode.Is(cjkCompatibilityForms, r) || + unicode.Is(smallFormVariants, r) || + unicode.Is(halfwidthAndFullwidthForms, r) || + unicode.Is(kanaSupplement, r) || + unicode.Is(kanaExtendedA, r) || + unicode.Is(smallKanaExtension, r) || + unicode.Is(cjkUnifiedIdeographsExtensionB, r) || + unicode.Is(cjkUnifiedIdeographsExtensionC, r) || + unicode.Is(cjkUnifiedIdeographsExtensionD, r) || + unicode.Is(cjkUnifiedIdeographsExtensionE, r) || + unicode.Is(cjkUnifiedIdeographsExtensionF, r) || + unicode.Is(cjkCompatibilityIdeographsSupplement, r) || + unicode.Is(cjkUnifiedIdeographsExtensionG, r) +} + +// EastAsianWidth returns the east asian width of the given rune. +// See https://www.unicode.org/reports/tr11/tr11-36.html +func EastAsianWidth(r rune) string { + switch { + case r == 0x3000, + (0xFF01 <= r && r <= 0xFF60), + (0xFFE0 <= r && r <= 0xFFE6): + return "F" + + case r == 0x20A9, + (0xFF61 <= r && r <= 0xFFBE), + (0xFFC2 <= r && r <= 0xFFC7), + (0xFFCA <= r && r <= 0xFFCF), + (0xFFD2 <= r && r <= 0xFFD7), + (0xFFDA <= r && r <= 0xFFDC), + (0xFFE8 <= r && r <= 0xFFEE): + return "H" + + case (0x1100 <= r && r <= 0x115F), + (0x11A3 <= r && r <= 0x11A7), + (0x11FA <= r && r <= 0x11FF), + (0x2329 <= r && r <= 0x232A), + (0x2E80 <= r && r <= 0x2E99), + (0x2E9B <= r && r <= 0x2EF3), + (0x2F00 <= r && r <= 0x2FD5), + (0x2FF0 <= r && r <= 0x2FFB), + (0x3001 <= r && r <= 0x303E), + (0x3041 <= r && r <= 0x3096), + (0x3099 <= r && r <= 0x30FF), + (0x3105 <= r && r <= 0x312D), + (0x3131 <= r && r <= 0x318E), + (0x3190 <= r && r <= 0x31BA), + (0x31C0 <= r && r <= 0x31E3), + (0x31F0 <= r && r <= 0x321E), + (0x3220 <= r && r <= 0x3247), + (0x3250 <= r && r <= 0x32FE), + (0x3300 <= r && r <= 0x4DBF), + (0x4E00 <= r && r <= 0xA48C), + (0xA490 <= r && r <= 0xA4C6), + (0xA960 <= r && r <= 0xA97C), + (0xAC00 <= r && r <= 0xD7A3), + (0xD7B0 <= r && r <= 0xD7C6), + (0xD7CB <= r && r <= 0xD7FB), + (0xF900 <= r && r <= 0xFAFF), + (0xFE10 <= r && r <= 0xFE19), + (0xFE30 <= r && r <= 0xFE52), + (0xFE54 <= r && r <= 0xFE66), + (0xFE68 <= r && r <= 0xFE6B), + (0x1B000 <= r && r <= 0x1B001), + (0x1F200 <= r && r <= 0x1F202), + (0x1F210 <= r && r <= 0x1F23A), + (0x1F240 <= r && r <= 0x1F248), + (0x1F250 <= r && r <= 0x1F251), + (0x20000 <= r && r <= 0x2F73F), + (0x2B740 <= r && r <= 0x2FFFD), + (0x30000 <= r && r <= 0x3FFFD): + return "W" + + case (0x0020 <= r && r <= 0x007E), + (0x00A2 <= r && r <= 0x00A3), + (0x00A5 <= r && r <= 0x00A6), + r == 0x00AC, + r == 0x00AF, + (0x27E6 <= r && r <= 0x27ED), + (0x2985 <= r && r <= 0x2986): + return "Na" + + case (0x00A1 == r), + (0x00A4 == r), + (0x00A7 <= r && r <= 0x00A8), + (0x00AA == r), + (0x00AD <= r && r <= 0x00AE), + (0x00B0 <= r && r <= 0x00B4), + (0x00B6 <= r && r <= 0x00BA), + (0x00BC <= r && r <= 0x00BF), + (0x00C6 == r), + (0x00D0 == r), + (0x00D7 <= r && r <= 0x00D8), + (0x00DE <= r && r <= 0x00E1), + (0x00E6 == r), + (0x00E8 <= r && r <= 0x00EA), + (0x00EC <= r && r <= 0x00ED), + (0x00F0 == r), + (0x00F2 <= r && r <= 0x00F3), + (0x00F7 <= r && r <= 0x00FA), + (0x00FC == r), + (0x00FE == r), + (0x0101 == r), + (0x0111 == r), + (0x0113 == r), + (0x011B == r), + (0x0126 <= r && r <= 0x0127), + (0x012B == r), + (0x0131 <= r && r <= 0x0133), + (0x0138 == r), + (0x013F <= r && r <= 0x0142), + (0x0144 == r), + (0x0148 <= r && r <= 0x014B), + (0x014D == r), + (0x0152 <= r && r <= 0x0153), + (0x0166 <= r && r <= 0x0167), + (0x016B == r), + (0x01CE == r), + (0x01D0 == r), + (0x01D2 == r), + (0x01D4 == r), + (0x01D6 == r), + (0x01D8 == r), + (0x01DA == r), + (0x01DC == r), + (0x0251 == r), + (0x0261 == r), + (0x02C4 == r), + (0x02C7 == r), + (0x02C9 <= r && r <= 0x02CB), + (0x02CD == r), + (0x02D0 == r), + (0x02D8 <= r && r <= 0x02DB), + (0x02DD == r), + (0x02DF == r), + (0x0300 <= r && r <= 0x036F), + (0x0391 <= r && r <= 0x03A1), + (0x03A3 <= r && r <= 0x03A9), + (0x03B1 <= r && r <= 0x03C1), + (0x03C3 <= r && r <= 0x03C9), + (0x0401 == r), + (0x0410 <= r && r <= 0x044F), + (0x0451 == r), + (0x2010 == r), + (0x2013 <= r && r <= 0x2016), + (0x2018 <= r && r <= 0x2019), + (0x201C <= r && r <= 0x201D), + (0x2020 <= r && r <= 0x2022), + (0x2024 <= r && r <= 0x2027), + (0x2030 == r), + (0x2032 <= r && r <= 0x2033), + (0x2035 == r), + (0x203B == r), + (0x203E == r), + (0x2074 == r), + (0x207F == r), + (0x2081 <= r && r <= 0x2084), + (0x20AC == r), + (0x2103 == r), + (0x2105 == r), + (0x2109 == r), + (0x2113 == r), + (0x2116 == r), + (0x2121 <= r && r <= 0x2122), + (0x2126 == r), + (0x212B == r), + (0x2153 <= r && r <= 0x2154), + (0x215B <= r && r <= 0x215E), + (0x2160 <= r && r <= 0x216B), + (0x2170 <= r && r <= 0x2179), + (0x2189 == r), + (0x2190 <= r && r <= 0x2199), + (0x21B8 <= r && r <= 0x21B9), + (0x21D2 == r), + (0x21D4 == r), + (0x21E7 == r), + (0x2200 == r), + (0x2202 <= r && r <= 0x2203), + (0x2207 <= r && r <= 0x2208), + (0x220B == r), + (0x220F == r), + (0x2211 == r), + (0x2215 == r), + (0x221A == r), + (0x221D <= r && r <= 0x2220), + (0x2223 == r), + (0x2225 == r), + (0x2227 <= r && r <= 0x222C), + (0x222E == r), + (0x2234 <= r && r <= 0x2237), + (0x223C <= r && r <= 0x223D), + (0x2248 == r), + (0x224C == r), + (0x2252 == r), + (0x2260 <= r && r <= 0x2261), + (0x2264 <= r && r <= 0x2267), + (0x226A <= r && r <= 0x226B), + (0x226E <= r && r <= 0x226F), + (0x2282 <= r && r <= 0x2283), + (0x2286 <= r && r <= 0x2287), + (0x2295 == r), + (0x2299 == r), + (0x22A5 == r), + (0x22BF == r), + (0x2312 == r), + (0x2460 <= r && r <= 0x24E9), + (0x24EB <= r && r <= 0x254B), + (0x2550 <= r && r <= 0x2573), + (0x2580 <= r && r <= 0x258F), + (0x2592 <= r && r <= 0x2595), + (0x25A0 <= r && r <= 0x25A1), + (0x25A3 <= r && r <= 0x25A9), + (0x25B2 <= r && r <= 0x25B3), + (0x25B6 <= r && r <= 0x25B7), + (0x25BC <= r && r <= 0x25BD), + (0x25C0 <= r && r <= 0x25C1), + (0x25C6 <= r && r <= 0x25C8), + (0x25CB == r), + (0x25CE <= r && r <= 0x25D1), + (0x25E2 <= r && r <= 0x25E5), + (0x25EF == r), + (0x2605 <= r && r <= 0x2606), + (0x2609 == r), + (0x260E <= r && r <= 0x260F), + (0x2614 <= r && r <= 0x2615), + (0x261C == r), + (0x261E == r), + (0x2640 == r), + (0x2642 == r), + (0x2660 <= r && r <= 0x2661), + (0x2663 <= r && r <= 0x2665), + (0x2667 <= r && r <= 0x266A), + (0x266C <= r && r <= 0x266D), + (0x266F == r), + (0x269E <= r && r <= 0x269F), + (0x26BE <= r && r <= 0x26BF), + (0x26C4 <= r && r <= 0x26CD), + (0x26CF <= r && r <= 0x26E1), + (0x26E3 == r), + (0x26E8 <= r && r <= 0x26FF), + (0x273D == r), + (0x2757 == r), + (0x2776 <= r && r <= 0x277F), + (0x2B55 <= r && r <= 0x2B59), + (0x3248 <= r && r <= 0x324F), + (0xE000 <= r && r <= 0xF8FF), + (0xFE00 <= r && r <= 0xFE0F), + (0xFFFD == r), + (0x1F100 <= r && r <= 0x1F10A), + (0x1F110 <= r && r <= 0x1F12D), + (0x1F130 <= r && r <= 0x1F169), + (0x1F170 <= r && r <= 0x1F19A), + (0xE0100 <= r && r <= 0xE01EF), + (0xF0000 <= r && r <= 0xFFFFD), + (0x100000 <= r && r <= 0x10FFFD): + return "A" + + default: + return "N" + } +} diff --git a/util/util_safe.go b/util/util_safe.go new file mode 100644 index 0000000..2f6a3fe --- /dev/null +++ b/util/util_safe.go @@ -0,0 +1,14 @@ +//go:build appengine || js +// +build appengine js + +package util + +// BytesToReadOnlyString returns a string converted from given bytes. +func BytesToReadOnlyString(b []byte) string { + return string(b) +} + +// StringToReadOnlyBytes returns bytes converted from given string. +func StringToReadOnlyBytes(s string) []byte { + return []byte(s) +} diff --git a/util/util_unsafe_go120.go b/util/util_unsafe_go120.go new file mode 100644 index 0000000..d6be534 --- /dev/null +++ b/util/util_unsafe_go120.go @@ -0,0 +1,24 @@ +//go:build !appengine && !js && !go1.21 +// +build !appengine,!js,!go1.21 + +package util + +import ( + "reflect" + "unsafe" +) + +// BytesToReadOnlyString returns a string converted from given bytes. +func BytesToReadOnlyString(b []byte) string { + return *(*string)(unsafe.Pointer(&b)) +} + +// StringToReadOnlyBytes returns bytes converted from given string. +func StringToReadOnlyBytes(s string) (bs []byte) { + sh := (*reflect.StringHeader)(unsafe.Pointer(&s)) + bh := (*reflect.SliceHeader)(unsafe.Pointer(&bs)) + bh.Data = sh.Data + bh.Cap = sh.Len + bh.Len = sh.Len + return +} diff --git a/util/util_unsafe_go121.go b/util/util_unsafe_go121.go new file mode 100644 index 0000000..50c7fce --- /dev/null +++ b/util/util_unsafe_go121.go @@ -0,0 +1,18 @@ +//go:build !appengine && !js && go1.21 +// +build !appengine,!js,go1.21 + +package util + +import ( + "unsafe" +) + +// BytesToReadOnlyString returns a string converted from given bytes. +func BytesToReadOnlyString(b []byte) string { + return unsafe.String(unsafe.SliceData(b), len(b)) +} + +// StringToReadOnlyBytes returns bytes converted from given string. +func StringToReadOnlyBytes(s string) []byte { + return unsafe.Slice(unsafe.StringData(s), len(s)) +}